KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408384
Entry
100408384         CDS       T03264                                 

Gene name
TRPM4
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 4
  KO
K04979  transient receptor potential cation channel subfamily M member 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100408384 (TRPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100408384 (TRPM4)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100408384 (TRPM4)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans NICE-3
Other DBs
NCBI-GeneID: 100408384
NCBI-ProteinID: XP_008986616
LinkDB
Position
22
AA seq 1209 aa
MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTWCQCGRPRTTHPAVATEDAFGAAVVTV
WDSDVHTTEKPTDAYGELDFMGTSRRHSHFLRLSDRTDPATVYNLVTRMWGFRAPNLVVS
VMGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGG
TKVVAMGVAPWGEVQKRDILTNPKGSFPAQYDWRHDPKDGVQFPLDYNYSAFFLVDDGTH
GRLGGENRFRLRLESYISQQKAGVGGTGIDIPVLLLLIDGDEKMLMQIENATQAQLPCLL
VAGSGGAADCLAETLEDTLALGSGGARQGEIQDRIRRFFPKGDPEVLRAQVERIMTRKEL
LTVYSSEDGAEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPTRLAQLYSAAPPNSLIHNLLDQA
SHGAGTKALALKGEAVEPRLPDVGHVLRMLLGKMCAPRYPARGTAEPHPGQGFEESKFLL
QDKAPSRSSLDAGLGQASWGDLLLWALLLNRAQMAMYFWRRXVGSNAVSSALGACLLLRV
MARLEPDAEEAARRKDLAIKFEGMGVDLYGKCYHSSEVRAARLLFRRCPLWGDATCLQLA
MQADARAFLAQDGVQSLLTQKWWGHMAHTTPTWALVLAFFCPPLIYTHLITFRKSEEEPT
QEDLESDLDSAANGEGPVRLEDPAERTSLGVARQPGRRGCCVGHGFLRRWVQFWCAPVTV
FMGNVVSYLLFLLLFARVLLVDFQPSPPGGLELLLYFWAFTLLCEELRQGLSGGWGSLAS
GGPGPGHASLRQRLQLYLADSWNQCDLVALTCFLLGVGCRLTPGLYDLGRAVFCLDFMVF
TLRLLHIFTVNKQLGPKIVIVNKMVKDVFFFLFFLGVWLVAYGVATEGLLRPQDSDLPSI
LRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFWAHPSGTQAGTCVSQYANWLVVL
LLVIFLLVANILLVNLLIAMFSYTFGKVQGNSDLYWKSQRYRLIREFHSRPALAPPLIII
SHSRLLLRKLCRSSRSTQAVIGDFRVPLSKEAERKLLTWESVQKENFLLARARDKRDSDS
ERLKRTSQKVDNALKQLGHIREYEQRLKVLEREVQHCSRVLGWMAEALSRSALLPPGGPP
PPDLPGPKD
NT seq 3630 nt   +upstreamnt  +downstreamnt
atggtggtgccggagaaggagcagagctggatccccaagatcttcaagaagaagacctgc
acgacgttcatagtcgactccacagatccgggagggacctggtgccagtgtgggcgcccc
cggaccacccaccccgctgtggccacagaggacgcctttggggcagccgtggtgaccgtg
tgggacagtgatgtgcacaccacggagaagcccacagacgcctacggagagctggacttc
atggggaccagccgaaggcacagccattttctccggctctctgaccgaacggatccagct
acagtttataatctggtcacacgcatgtggggcttccgtgccccaaacctagtggtgtca
gtgatggggggatcagggggccctgtcctccagacctggctgcaggacctgctgcgtcgt
gggctggtgcgggctgcccagagcacaggggcctggatcgtcactgggggcctgcacact
ggcattggccggcatgtgggcgtggctgtgcgcgaccatcagacggccagcactggaggc
accaaggtggtggccatgggcgtggccccctggggtgaggtccagaaaagagacatcctc
accaaccccaagggctcgttccccgcacagtatgattggcgccacgacccgaaggacggg
gtccagtttcccctggactacaactactcggccttcttcctggtggacgacggcacgcat
ggccgtctggggggcgagaaccgcttccgcttgcgcttggagtcctacatctcccagcag
aaggcgggtgtgggggggactggaattgacatccctgtcctgctcctcctgattgatggt
gatgagaagatgttgatgcaaatagagaatgccacccaggcccagctcccctgtctcctg
gtggctggctctggaggggctgcagactgcctggcagagaccttggaagacactctggcc
ctcgggagtgggggagccaggcaaggtgaaatccaagatcgaatccggcgtttctttccc
aaaggggaccctgaggtcctgcgggcccaggtggagaggattatgacccggaaggagctc
ctgacagtctattcttctgaggatggggctgaggaattcgagaccatagttttgaaggcc
ctcgtgaaggcctgtggaagctcagaggcctcagcttacctggacgagctgcgtttggct
gtggcttggaaccgcgtggacattgcccagagcgaactctttcggggggacatccagtgg
cggtccttccatctcgaggcctccctcatggacgccctgctgaatgaccggccggagttc
gtgcgcttgctcatctcccatggcctcagcctgggccacttcctgaccccgacacgcctg
gcccaactctatagcgcagcgccccccaactcgctcatccacaaccttttggaccaggcg
tcccacggtgcaggcaccaaagccctagctctaaaaggggaagctgtggagccccggctc
cctgatgtggggcacgtgctgaggatgcttctggggaagatgtgtgcaccgagatacccc
gccaggggcaccgcggaacctcacccaggccagggcttcgaggagagtaagtttctactc
caggacaaggccccctcaaggtcctcgctggacgctggccttgggcaggcctcctggggt
gacctgctcctttgggcgctgctgctgaacagggcacagatggccatgtacttctggaga
aggtgagtgggttccaatgcagtttcctctgctcttggggcctgtttgctgctccgggtg
atggcacgcctggagcctgatgctgaggaggcagcgcggaggaaagacctggcaatcaag
tttgaggggatgggcgttgacctctatggtaagtgctatcacagcagtgaggtaagggct
gcccgcctcctcttccgtcgctgcccgctctggggggatgccacttgcctccagctggcc
atgcaagctgatgcccgtgccttccttgcccaggatggagtacagtctctgctgacacag
aagtggtggggacacatggcccacaccacacccacctgggccctggttctcgccttcttt
tgccccccactcatctatacccacctcatcaccttcaggaaatcagaagaggagcccaca
caggaggatctggagtctgacctggacagtgctgctaatggggaagggcctgtcaggctg
gaggaccccgcggagaggacgtcactgggggtcgcacgccagccgggccgccggggctgc
tgcgtggggcacgggttcctgcgccgctgggtgcaattctggtgcgctccggtgacggtc
ttcatgggcaacgtggtcagctacctgctgttcctgctgctgtttgcgcgggtgctgctc
gtggacttccagccctcgccgcccggcggcctggagctgctgctctacttctgggctttc
acgctgctgtgcgaggagctgcgccagggcctgagcgggggctggggcagcctggccagt
gggggccccgggcctggtcatgcctcgctgcgccagcgcctgcagctctacctcgccgac
agctggaaccagtgcgacctagtggccctcacctgcttcctcctgggcgtgggctgccgg
ctgaccccaggtttgtacgacctgggccgcgctgtcttctgcctcgacttcatggttttc
acgctgcggctgctgcacatcttcacagtcaacaaacagctggggcccaagatcgtcatc
gtgaacaagatggtgaaggatgtgttcttctttctcttcttcctcggcgtgtggttagtg
gcctatggcgtggccacggaggggctcctaaggccccaggacagtgacctcccaagtatc
ctgcgccgtgtcttctaccgtccctacctgcagatcttcgggcagatcccccaggaagac
atggacgtggccctcatggagcacagcaactgctcatcagagcccggcttctgggcgcac
ccttccgggacccaggcgggcacctgcgtctcccagtatgccaactggctggtggtgctg
ctcctcgtcatcttcctgcttgtggccaacatcctgctggtcaacctgctcatcgccatg
ttcagctacacgttcggcaaagtacagggcaacagcgacctctactggaagtcgcaacgc
taccgcctcatccgggaattccactctcggcccgcgctggccccgccccttatcatcatc
tcccactcgcgcctcctgctcaggaaattgtgccggagctcccggagcacccaggcggtc
atcggggatttccgagtccctctttctaaggaagccgagcggaagctgctgacttgggaa
tcggtgcaaaaggagaacttcctgctggcacgcgctcgggacaagcgggacagcgactcc
gagcgtctgaagcgcacgtcgcagaaggtggacaatgcgctgaaacagctgggacacatc
cgcgagtacgaacagcgcctgaaagtgctggagcgggaggtccagcactgtagccgcgtc
ctggggtggatggccgaggccctgagccgctctgccttgctgcccccaggagggccgcca
ccccccgatctgcctgggcccaaagactga

DBGET integrated database retrieval system