KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409758
Entry
100409758         CDS       T03264                                 

Gene name
ERBB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100409758 (ERBB3)
   04012 ErbB signaling pathway
    100409758 (ERBB3)
   04020 Calcium signaling pathway
    100409758 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100409758 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100409758 (ERBB3)
   05205 Proteoglycans in cancer
    100409758 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100409758 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100409758 (ERBB3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100409758 (ERBB3)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100409758 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100409758
NCBI-ProteinID: XP_017831619
Ensembl: ENSCJAG00000011936
LinkDB
Position
9
AA seq 1341 aa
MRANGALQVLGLLFSLTRGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYEKCEVVM
GNLEIVLTGRNADLSFLQWIREVTGYVLVAMNEFSILPLSNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHLDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFQTVQEITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKLLRGPSEE
RLDIKHNRPRRECVAEGKVCDPQCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHESECFSCHPECQPMEGTATCNGSGSDTCVQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCRGQTLVLIGKTHLTMALTVIAGLVMIFMFLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHREALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMSFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCELLXXXXRPTFKE
LAQXVTRMARDPPRYLVIKRESGPGIDPGAEHHGLTNKELEEVELEPELDLDPDLEAEED
NLTTTTLGSVLSLPVGTLTRQRGSQSLLNPSSGYMPMNQGNLGEACQESAVSQGSEWCPR
PVSLHPMPRGRLVSESSEGHVTGSEVELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRHSPPRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYE
YMNRQRGGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDS
AFDNPDYWHSRLFPKANAQRT
NT seq 4026 nt   +upstreamnt  +downstreamnt
atgagggcgaacggcgctctgcaggtgctgggcttgcttttcagcctgacccggggctca
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatgggctgagtgtgactggc
gatgctgagaaccaataccagacactgtacaagctctacgagaagtgtgaggtggtgatg
gggaacctcgagattgtgctcacaggacgcaatgccgacctctccttcctgcagtggatt
cgagaagtgactggctatgtcctcgtggccatgaatgaattctctatattaccattgtcc
aaccttcgcgtggtgcgggggacccaggtctacgatgggaagtttgccatcttcgtcatg
ttgaactacaacaccaattccagccatgctctgcgccagctccgcttgactcagctcact
gagattctgtcagggggtgtttatattgagaagaacgacaagctttgtcacttggacaca
attgactggagggacatcgtgagggaccgagatgctgagatagtagtgaaggacaatggc
agaagctgtcccccctgtcatgaggtttgcaaggggcgatgctggggtcctggaccagaa
gactgccagacattgaccaagaccatctgtgcccctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgatgtcca
cagcctcttgtctacaacaaactaactttccagctggaacccaatccccacacaaagtat
cagtatggaggagtttgtgtagctagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagagcctgtcctcctgacaagatggaagtagataaaaacgggctgaagatatgt
gagccttgtgggggactatgtcccaaagcctgtgaggggacaggctctgggagccgcttc
cagactgtggactcaagcaacatcgatggatttgtgaactgcaccaagatcctgggcaac
ctggacttcctgatcactggcctcaatggagacccctggcacaagatacctgccctggac
ccagagaagctcaatgtcttccagacagtacaggagatcacaggttacctgaacatccag
tcctggcctccccacatgcacaacttcagtgttttttccaacttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaatcagtgctgggcgtatctatataagtgccaatcgg
cagctctgttaccaccactctttgaactggaccaaactgcttcgggggccttcagaagag
cgactagacatcaagcataatcggccccgcagagaatgcgtggcagagggcaaagtgtgt
gacccacagtgctcctctgggggatgctggggcccgggccctggtcagtgcttgtcctgt
cgaaactacagccgaggaggtgtctgtgtaacccactgcaactttctgaatggggagccc
cgagagtttgcccatgagtccgaatgcttctcttgccacccggaatgccagcccatggag
ggaactgccacatgcaatggctcgggctctgatacttgtgttcaatgtgcccattttcga
gatgggccccactgtgtgagtagctgcccccatggagtcctaggtgccaaaggccccatc
tacaagtacccagatgttcagaatgaatgtcggccttgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtcgaggacaaacactggtgctgatcggcaaaacc
cacctgacaatggctctgacagtgatagcaggattggtaatgattttcatgttcctgggt
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctgaggaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgagtcaatcaagattccagtctgc
attaaagtaattgaggacaagagtggacggcagagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacatcgtacggctgctaggactatgcccaggg
tcatctctgcagcttgtcactcaatacttgcctctgggttctctattggatcatgtgaga
caacaccgggaagcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggtatgtactaccttgaggaacatggtatggtgcatagaaacctcgctgcccgaaatgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctactatacagtgaggccaagactccaattaagtggatggccctt
gaaagtatccactttgggaaatacacacaccagagtgacgtctggagctatggtgtgaca
gtttgggagttgatgagcttcggggcagagccctatgcagggctgcgattggctgaagta
ccagacctgctagagaagggggagcggttggcacagccccagatctgcacaatcgatgtc
tacatggtgatggtcaagtgtgagttacttnnnnnnnnnnttcgcccaacctttaaagaa
ttagcccaatgagtcaccaggatggcccgagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagaccctggggcagagcaccatggtctgacaaacaaagagctg
gaggaagtagagctggagccagaactagacctagatccagacttggaagcagaggaggac
aacctgacaaccaccacactgggctccgtcctcagcctaccagttggaacacttactcgg
caacgtgggagccagagccttttaaatccatcatctggatacatgcccatgaaccagggt
aaccttggggaggcttgccaggagtctgcagtttctcagggcagtgaatggtgcccccgt
ccagtctctctgcacccaatgccacggggacgcctggtatcagagtcatcagagggccat
gtaacaggctctgaggttgagctccaggagaaagtgtcaatgtgtaggagccggagcagg
agccggagcccacggccacgtggagacagtgcctaccattcccagcgccacagtctgctt
actcctgtcacccctctctccccaccaggattagaggaagaggatgtcaatggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggagaaggcacagcccacctcgtccccctaggccaagttcccttgaggagttgggt
tatgagtacatggatgtggggtcagacctcagtgcctctctgggcagcacacagagttgc
ccactccaccctgtaccaatcatgcccactgctggcacaactccagatgaagattatgaa
tatatgaatcggcaacgaggtggaggtggtcctgggggtgattatgcagccatgggggcc
tgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacatcag
gcccctcacgtccattatgcccgcctaaaaactctacgtagcttagaggctacagactct
gcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcgcagaga
acataa

DBGET integrated database retrieval system