KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412906
Entry
100412906         CDS       T03264                                 

Gene name
PDGFA
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04630  JAK-STAT signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05231  Choline metabolism in cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100412906 (PDGFA)
   04014 Ras signaling pathway
    100412906 (PDGFA)
   04015 Rap1 signaling pathway
    100412906 (PDGFA)
   04630 JAK-STAT signaling pathway
    100412906 (PDGFA)
   04020 Calcium signaling pathway
    100412906 (PDGFA)
   04072 Phospholipase D signaling pathway
    100412906 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100412906 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100412906 (PDGFA)
   04540 Gap junction
    100412906 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100412906 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412906 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100412906 (PDGFA)
   05206 MicroRNAs in cancer
    100412906 (PDGFA)
   05231 Choline metabolism in cancer
    100412906 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100412906 (PDGFA)
   05218 Melanoma
    100412906 (PDGFA)
   05215 Prostate cancer
    100412906 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100412906 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100412906 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100412906 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100412906 (PDGFA)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100412906 (PDGFA)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100412906 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 100412906
NCBI-ProteinID: XP_017824812
Ensembl: ENSCJAG00000004948
UniProt: U3CXU3
LinkDB
Position
2
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGNEDALD
TSLRAHGVHATKHAPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECACA
TTSLNPDYREEDTGRPRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgctctggcc
gaggaagccgagatcccccgcgaggtgatcgagaggctggcgcacagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtagggaatgaggatgctttggac
accagcttgagagctcacggggtccacgccaccaagcatgcacctgagaagcggcccctg
cccattcgaaggaagagaagtatcgaggaagctgttcccgctgtttgcaagaccaggaca
gtcatttatgagattcctcgaagccaggttgaccccacgtccgccaacttcctgatctgg
cccccgtgtgtggaggtgaagcgttgcaccggctgctgcaacaccagcagcgtcaagtgt
cagccctcccgcgtccaccaccgcagcgttaaggtggccaaggtggaatacatcaggaag
aagccaaaattaaaagaagtccaggtgaggttagaggagcatttggagtgcgcctgtgca
accaccagcctgaatccggattatcgggaagaggacacaggaaggcctagggagtcaggt
aaaaagcggaaaagaaaaaggttaaaacccacctaa

DBGET integrated database retrieval system