KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414132
Entry
100414132         CDS       T03264                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05133  Pertussis
cjc05135  Yersinia infection
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05203  Viral carcinogenesis
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100414132 (IRF3)
   04621 NOD-like receptor signaling pathway
    100414132 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    100414132 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    100414132 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100414132 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100414132 (IRF3)
   05161 Hepatitis B
    100414132 (IRF3)
   05160 Hepatitis C
    100414132 (IRF3)
   05171 Coronavirus disease - COVID-19
    100414132 (IRF3)
   05164 Influenza A
    100414132 (IRF3)
   05162 Measles
    100414132 (IRF3)
   05168 Herpes simplex virus 1 infection
    100414132 (IRF3)
   05163 Human cytomegalovirus infection
    100414132 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100414132 (IRF3)
   05169 Epstein-Barr virus infection
    100414132 (IRF3)
   05165 Human papillomavirus infection
    100414132 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100414132 (IRF3)
   05133 Pertussis
    100414132 (IRF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100414132 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414132 (IRF3)
   04131 Membrane trafficking [BR:cjc04131]
    100414132 (IRF3)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100414132 (IRF3)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100414132 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100414132
NCBI-ProteinID: XP_002762423
Ensembl: ENSCJAG00000003637
LinkDB
Position
22
AA seq 432 aa
MMGRTMGTPKPRILPWLELQLNLGQLEGVAWVNESRTRFRIPWKHGLRHDAQQEDFGIFQ
AWAEATGAYVPGRDKPDPPTWKRNFRSALNRKDGLRLADDRSKDPHDPHKIYEFVNSAVG
NFAQPDTSPDTSGGGSTFDTQEDILDELLGNMVLAPLPDSGPPGLAVAPEPYPQPLLSPS
LDNPTPFPNPEPSENPLRRLLVPGEEWEFEVTAFYRGRQVFQQTISCPGGLRLVGSEVAD
RTLPGWPITLPDPGASLTDKGVMTYVRHVLSRLGGGLALWQAGQQLWAQRLGQCHTYWAV
SEELLPNSGNGPDGEVPKDKEGGVLDLGPFIVDLITFTEGSGRSPRYTLWFCVGEPWPQD
QPWTKRLVMVKVVPTCLRALVELARAGGASSLENTVELHISNSHPLSLTSDQYKAYLKDL
VEDMDFQGPGEA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgatgggccggaccatgggaaccccaaagccacggatcctgccctggctggagttgcag
ctgaatctggggcagctggagggtgtggcctgggtgaatgagagccgcacgcgcttccgc
atcccttggaaacacggtctacggcatgatgcacagcaggaggatttcggaatcttccag
gcctgggctgaggccactggtgcatacgttcccgggagagataagccagacccgccaacc
tggaagaggaatttccgttctgccctcaaccgcaaagatggattgcgtttagcagatgac
cgaagcaaggaccctcacgacccacataagatctacgagtttgtgaactcagcagttggg
aactttgcccagccagacacatctccagacaccagtggcggaggcagtacttttgatacc
caggaagacattctggatgagttactgggtaacatggtcttggccccactcccagattcg
ggaccaccaggcctggctgtagcccctgagccctaccctcagcccctgctgagccccagc
ttggataatcccacgcccttcccaaacccggagccctctgagaatccactgaggcggctg
ctggtgccgggggaagagtgggagttcgaggtgacagccttctaccggggccgccaagtc
ttccagcagaccatctcctgcccagggggcctgcggctggtggggtcggaagtggcagac
aggacgctgcctggatggcccatcacactgccagaccctggcgcatccctgacagacaag
ggcgtgatgacctatgtgaggcacgtgctgagccgcctgggtgggggactggctctgtgg
caggccggacagcagctctgggcccagcggctggggcagtgccacacgtactgggcagtg
agcgaggagttgctccccaacagtgggaatgggcctgatggcgaggttcccaaggacaag
gaaggaggcgtgctcgacctgggacccttcattgtagatctgattaccttcactgaagga
agcggacgctcaccacgctataccctctggttctgtgttggggagccatggccccaggac
cagccatggaccaagaggctcgtgatggtcaaggttgtgcccacatgcctcagggccttg
gtagagctggcccgggcagggggtgcctcctccctggagaacacagtggaactgcacatt
tccaacagccacccactctccctcacctctgaccagtacaaggcctacctgaaggacttg
gtggaggacatggatttccagggccctggggaggcctga

DBGET integrated database retrieval system