KEGG   Chelonia mydas (green sea turtle): 102947354
Entry
102947354         CDS       T02989                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04137  Mitophagy - animal
cmy04210  Apoptosis
cmy04218  Cellular senescence
cmy04620  Toll-like receptor signaling pathway
cmy04621  NOD-like receptor signaling pathway
cmy04622  RIG-I-like receptor signaling pathway
cmy04623  Cytosolic DNA-sensing pathway
cmy04625  C-type lectin receptor signaling pathway
cmy04920  Adipocytokine signaling pathway
cmy05132  Salmonella infection
cmy05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102947354 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102947354 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102947354 (RELA)
   04218 Cellular senescence
    102947354 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102947354 (RELA)
   04621 NOD-like receptor signaling pathway
    102947354 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102947354 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102947354 (RELA)
   04625 C-type lectin receptor signaling pathway
    102947354 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102947354 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102947354 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102947354 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmy03000]
    102947354 (RELA)
Transcription factors [BR:cmy03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102947354 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102947354
NCBI-ProteinID: XP_007056224
LinkDB
Position
Un
AA seq 526 aa
MRFRYKCEGRSAGSIPGEHSTDTTKTHPTIKINNYTGPGKVRISLVTKDTPHRPHPHELV
GKDCKDGYYEAELSPERNIHSFQNLGIQCVKKRELDEAVAQRIRTNNNPFNVPLDNQKGD
YDLNAVRLCFQVWVQDPVGTGHLVPLPLVVSQPIYDHRAPNTAELKICRVNRNSGSCLGG
DEIFLLCDKVQKEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYQDQALREPVTVQ
MQLRRPSDKEVSEAMEFRYLPDEGDFHRIEEKRKRTRDTFKNFVQKAPFAAVVVPESRSP
RRIAVPARTAAMPKPSLIRPSMSGLTGMAGTMGQLPTIQKPQATAPHPPLPFPRPHRAPP
PPTPQLGFSTVNLEEFSSLGISSRAQPPPPAPEAEPNFDPFFPLPLEGGDSVAMELGALL
EDTTYTSLESINTTEFRQLLSQGSSTEGADGHSMLLTYPESITRLMSSQRGVVGVTGEEP
QGNGGGGGAGGANSFINGVLGSLPEENLTSMGDLDFSALLSQFSSS
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcgcttccgctacaagtgtgaggggcgctcggccggcagcatccccggggagcacagc
actgacaccaccaagacccaccccaccatcaagatcaataattacacaggccccgggaag
gttcgtatctctcttgtgaccaaggacaccccccaccgaccccacccccacgagttggtg
ggcaaggactgcaaggacggctactatgaggctgagctttcacctgagcgcaacatccac
agcttccagaacctgggcatccagtgcgtgaagaaacgggagctggacgaggctgtggca
cagcgcatccgcaccaacaataaccccttcaatgtgcccctggacaaccagaagggggac
tatgacttgaacgctgtgcggctctgcttccaggtgtgggtgcaggaccctgtgggcacc
gggcacctcgtcccgctgcccctcgtggtgtcacagccgatctacgaccaccgagccccc
aacacggctgagctgaagatctgccgggtcaatcgcaactcggggagctgtctgggtggg
gacgagatcttcctgctctgcgacaaggtgcagaaagaggacattgaggtccgattcttc
aaggactcgtgggaggccaagggctccttctcgcaggcagacgtgcaccggcaggttgcc
atcgtgttcaaaaccccaccctaccaggaccaggcgctcagggagccggtgacggtgcag
atgcagctccggcgcccatctgacaaggaggtcagcgaggccatggagttccgctacctg
ccagatgaaggcgacttccaccgcatcgaggagaagcgcaagcgaacgcgggacaccttc
aagaactttgtgcagaaagcgcctttcgcagcagtggtggttccagagtcacgctccccg
cgtcggatcgctgtccccgcccgcacagctgccatgcccaaacccagcctcatccgaccc
agtatgagtggtctcaccggaatggcgggcaccatggggcagctgccgaccatccagaag
ccgcaggccacggccccgcacccccccctacccttcccccggccccaccgagctcctcct
cctcccaccccccagctgggcttcagtacagtcaacctggaggagttctccagcctgggc
atctcaagccgggcccagcccccaccccctgctcccgaggccgagcccaactttgacccc
ttcttccccctgccgcttgaggggggcgactcagtcgccatggagctgggggccttgctg
gaggacaccacctacaccagcctggagtccatcaacactactgagttccggcagctgctg
agccaggggtcgtccaccgagggtgctgacgggcacagcatgctcctgacctatcccgag
tcgatcacccgcctgatgagcagccagcgtggtgtggtgggcgtgacaggggaggagcca
cagggcaacggcgggggtgggggggccggcggtgccaacagcttcatcaacggggtcctg
ggcagcctcccggaagagaacctcacctccatgggggatctggacttcagcgccctgctc
agccagttcagttcctcttag

DBGET integrated database retrieval system