KEGG   Cedecea neteri SSMD04: JT31_07710Help
Entry
JT31_07710        CDS       T03298                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00330  Arginine and proline metabolism
cnt01100  Metabolic pathways
cnt01110  Biosynthesis of secondary metabolites
cnt01130  Biosynthesis of antibiotics
cnt01230  Biosynthesis of amino acids
Module
cnt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    JT31_07710
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     JT31_07710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH IlvN 3HCDH_N Sacchrp_dh_NADP Helicase_RecD 2-Hacid_dh_C NAD_Gly3P_dh_N PDH GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AIR04499
UniProt: A0A089Q1Y0
LinkDB All DBs
Position
1636645..1637454
Genome map
AA seq 269 aa AA seqDB search
MDKKIGFIGCGNMGKAILGGLISSGLVPAGNIWVYTPSPDKVQALCEEYGINPAQSAQEV
AQIADIVFGAVKPNIMLKVLSEVNSELNKDSVVISIAAGITLETLAKVLGHDRKIIRAMP
NTPALVNAGMTSVTPNALVTPEDIADAVSIFRSFGQAEVVSEAMIHPVVGVSGSAPAYVF
MFIEAMADAAVLGGMPRKQAYQFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAV
KVLEEKGFRAAVMEAMVKCMAKSELLGKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaaattggctttattggctgcggtaacatgggcaaagcgatccttggcggc
ctgatttccagcggcctggtgccggcgggcaatatctgggtttataccccgtcgccggac
aaggtgcaggcattatgcgaagaatacggcattaatccggcgcagagcgcgcaggaagtc
gcgcagatagccgacatcgtttttggcgcggtgaagccaaacatcatgctgaaagtgctg
agcgaagtgaattccgagctgaataaagacagcgttgttatctccattgccgcaggcatt
accctggaaaccctcgccaaagtgctgggccacgaccgcaagattatccgtgcaatgccg
aataccccggcgctggtgaatgcaggcatgacgtcggtgacgccaaacgcgctggtcacg
cctgaagatattgccgatgcggtaagcattttccgcagctttggccaggcggaagtggta
agcgaagcgatgatccatccggtggtgggcgtcagcggttcagcgccggcttacgtcttt
atgtttatcgaagccatggccgacgccgccgtgctgggcggtatgccgcgtaaacaggcc
tatcagtttgccgctcaggcggtgatgggctcggcgaaaatggtgctggaaaccgggaag
catccgggcgagctgaaagacatggtttgctcccctggcggcaccaccattgaggcagtc
aaagtgctggaagagaaaggcttccgcgctgccgtgatggaagcgatggtgaagtgtatg
gcgaagtcggagctgctcgggaagtcctga

DBGET integrated database retrieval system