KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009900
Entry
CpipJ_CPIJ009900  CDS       T01079                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02373  FAS-associated death domain protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04215  Apoptosis - multiple species
cqu04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ009900
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    CpipJ_CPIJ009900
SSDB
Motif
Pfam: Death JIP_LZII
Other DBs
NCBI-ProteinID: EDS33580
VectorBase: CPIJ009900
UniProt: B0WRX0
LinkDB
AA seq 255 aa
MAAALLQDRAVYEQLCKDYLNLKTLACGCCHSPEAIQRCKEALRGEINSARKLGRLNQLE
EVLALLETRNALSMIKVGLLGRLQPLVKDDEFGRRLSDFNVSLDRSFTSVRRYYLEDLRH
RDRRTLLEKELEQVKLADPEDIPKPETPTNPEKSSSTPQIDSTAYQVCRLGIFDLLAREI
SRDWNALGRNLQLSAGSLYAIEERHPRDVRARVQEVLEQAEAEHGMGAGFVRLLGEALVS
TRRKDLKRKLDKMLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccgcagctctcctgcaggatcgcgccgtgtacgagcagctgtgcaaagattatctc
aatctaaaaacgcttgcctgcggctgttgccactcgccggaagcgatccaacggtgcaag
gaagcactgcgaggggagataaattcggcccggaagctgggtcggctaaaccagctggag
gaagtgctggctctgttggagactagaaacgcattaagcatgatcaaggttgggctgttg
ggccggttgcagccgctggtcaaggatgatgagtttggaaggaggttgtctgattttaat
gtttcgctggatcgaagcttcacttccgtcaggaggtactatttggaagaccttcgacac
cgcgatcggcgaacgctgctagaaaaagaactggaacaggtcaagcttgcagatcctgag
gatattccaaaaccggaaacgccaaccaatccggaaaagagcagctcaactccccaaatt
gattccacagcgtaccaagtctgtcggctgggcatttttgaccttctggcgagggaaata
agtcgcgactggaacgcgctgggccggaatttgcagctgagtgcgggcagtttgtacgcg
atcgaggagcgacacccgcgggacgttcgtgcacgcgtccaggaagtgttggagcaagcc
gaagcggaacatggaatgggggcgggatttgtgcggctgctgggtgaggcgttggttagc
acgagaagaaaggatttgaagcggaagttggacaaaatgttgagttga

DBGET integrated database retrieval system