KEGG   Chlorocebus sabaeus (green monkey): 103232832
Entry
103232832         CDS       T04361                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01523  Antifolate resistance
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04062  Chemokine signaling pathway
csab04064  NF-kappa B signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04380  Osteoclast differentiation
csab04620  Toll-like receptor signaling pathway
csab04621  NOD-like receptor signaling pathway
csab04622  RIG-I-like receptor signaling pathway
csab04623  Cytosolic DNA-sensing pathway
csab04625  C-type lectin receptor signaling pathway
csab04657  IL-17 signaling pathway
csab04658  Th1 and Th2 cell differentiation
csab04659  Th17 cell differentiation
csab04660  T cell receptor signaling pathway
csab04662  B cell receptor signaling pathway
csab04668  TNF signaling pathway
csab04920  Adipocytokine signaling pathway
csab05132  Salmonella infection
csab05135  Yersinia infection
csab05142  Chagas disease
csab05145  Toxoplasmosis
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05162  Measles
csab05163  Human cytomegalovirus infection
csab05164  Influenza A
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05168  Herpes simplex virus 1 infection
csab05169  Epstein-Barr virus infection
csab05170  Human immunodeficiency virus 1 infection
csab05200  Pathways in cancer
csab05203  Viral carcinogenesis
csab05212  Pancreatic cancer
csab05215  Prostate cancer
csab05220  Chronic myeloid leukemia
csab05221  Acute myeloid leukemia
csab05222  Small cell lung cancer
csab05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csab05340  Primary immunodeficiency
csab05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103232832 (IKBKG)
   04014 Ras signaling pathway
    103232832 (IKBKG)
   04064 NF-kappa B signaling pathway
    103232832 (IKBKG)
   04668 TNF signaling pathway
    103232832 (IKBKG)
   04151 PI3K-Akt signaling pathway
    103232832 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103232832 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103232832 (IKBKG)
   04621 NOD-like receptor signaling pathway
    103232832 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    103232832 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    103232832 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    103232832 (IKBKG)
   04660 T cell receptor signaling pathway
    103232832 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    103232832 (IKBKG)
   04659 Th17 cell differentiation
    103232832 (IKBKG)
   04657 IL-17 signaling pathway
    103232832 (IKBKG)
   04662 B cell receptor signaling pathway
    103232832 (IKBKG)
   04062 Chemokine signaling pathway
    103232832 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103232832 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103232832 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103232832 (IKBKG)
   05203 Viral carcinogenesis
    103232832 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103232832 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103232832 (IKBKG)
   05221 Acute myeloid leukemia
    103232832 (IKBKG)
   05220 Chronic myeloid leukemia
    103232832 (IKBKG)
   05215 Prostate cancer
    103232832 (IKBKG)
   05222 Small cell lung cancer
    103232832 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    103232832 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103232832 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103232832 (IKBKG)
   05135 Yersinia infection
    103232832 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103232832 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    103232832 (IKBKG)
   05162 Measles
    103232832 (IKBKG)
   05164 Influenza A
    103232832 (IKBKG)
   05161 Hepatitis B
    103232832 (IKBKG)
   05160 Hepatitis C
    103232832 (IKBKG)
   05168 Herpes simplex virus 1 infection
    103232832 (IKBKG)
   05163 Human cytomegalovirus infection
    103232832 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103232832 (IKBKG)
   05169 Epstein-Barr virus infection
    103232832 (IKBKG)
   05165 Human papillomavirus infection
    103232832 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103232832 (IKBKG)
   05142 Chagas disease
    103232832 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103232832 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103232832 (IKBKG)
Protein kinases [BR:csab01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103232832 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 103232832
NCBI-ProteinID: XP_007991348
Ensembl: ENSCSAG00000006727
LinkDB
Position
X
AA seq 430 aa
MALVIQPLPCWMSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPE
TLQRCLEENQELRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSL
EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQT
LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQ
LQVAYHQLFQEYDNHIKSSLVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE
QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE
SARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDT
LQIHVMECIE
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggcccttgtgatccagcccctgccctgttggatgagcaggcacctctggaagagccaa
ctgtgtgagatggtgcagcccagtggtggcccggcagcagatcaggacgtgctgggtgaa
gagtctcctctggggaagccagccatgctgcacctgccttcagagcaaggcgctcctgag
actctccagcgctgcctggaggagaatcaagagctccgagatgccatccggcagagcaac
cagatgctgcgagagcgctgcgaggagcttctgcatttccaagccagccagagggaggag
aaggagttcctcatgtgcaaattccaagaggccaggaaactggtggagagactcagcctg
gagaagctcgacctgaagaggcagaaagagcaggctctgcgggaggtagagcacctgaag
agatgccagcagcagatggctgaggacaaggcctctgtgaaagcccaggtgacatccttg
ctcggggagctgcaggagagccagagtcgcttggaggctgccactaaggaatgccagact
ctggagggtcgggcccgggcggccagcgagcaggcgcggcagctggagagtgagcgtgag
gcactgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtg
gaggccgcactccgcatggagcgccaggctgcctcggaggagaagcggaagctggcccag
ttgcaggtggcctatcaccagctcttccaagaatacgacaaccacatcaagagcagcctg
gtgggcagcgagcggaagcgaggaatgcagctggaagatctcaagcagcagctccagcag
gccgaggaggccctggtggccaaacaggaggtgatcgataagctgaaggaggaggccgag
cagcacaagattgtgatggagaccgttccggtgctgaaggcccaggcggacatctacaag
gcggacttccaggctgagaggcaggctcgggagaagctggccgagaagaaggagctcttg
caggagcagctggagcagctgcagagggagtacagcaaactgaaggccagctgtcaggag
tcggccaggatcgaggacatgaggaagcggcatgttgaggtctcccaggcccccttgccc
cccgcccccgcctacctctcctctcccctggccctgcccagccagaggaggagcccccct
gaggagccacctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacacc
ctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system