KEGG   Cynoglossus semilaevis (tongue sole): 103382250
Entry
103382250         CDS       T04866                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04115  p53 signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04218  Cellular senescence
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103382250 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103382250 (pten)
   04070 Phosphatidylinositol signaling system
    103382250 (pten)
   04150 mTOR signaling pathway
    103382250 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103382250 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    103382250 (pten)
   04218 Cellular senescence
    103382250 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103382250 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103382250 (pten)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103382250 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     103382250 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103382250 (pten)
Protein phosphatases and associated proteins [BR:csem01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103382250 (pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 103382250
NCBI-ProteinID: XP_008313192
LinkDB
Position
8
AA seq 447 aa
MAALIKEIVSRKKRRYQEDGFDLDLTYIYPNIIAMGFRAERLEGVYRNNIDDVIRFLDSK
HKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIRPFCEDLDQWLREDEHHVA
AIHCKAGKGRTGVMICAYLLHRGRFQEAQDALDFYGEVRTHDKKGVTIPSQRRYVIYYSC
LLRNQLQYKPVALLFHKMLFETVPMFTAGTCSKTAPTAPRTTHHTNLDTQTPNRLTVWLC
SAADPQFVVYQLKVKIHTSNPTHTRREDKVMLFEFPQPLPVCGDIKVEFFHKQNKMMKKE
KMFHFWVNTFFIPGPEENQEKLENGSTGALRDTTNRTHQNPGLVTSAMTSVDGNDRDFLV
LTLNKNNLDKANKDKANRNFSPNFKVKLFFTKTVEEGANCDASSTSASVTPDVSDNEPDH
YRYSDTTDSDPENELCDDDDHDQITKV
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcggccttaatcaaggagatcgtgagcaggaaaaagaggcggtaccaggaggacggc
ttcgatctggacctgacatatatttatccgaacatcattgctatggggtttcgtgctgag
cgtctggagggcgtctacagaaacaacattgacgatgttattcgattcttagactcgaag
cacaagaaccattacaagatctacaacctgtgtgcggagcgacattatgactcgtcaaag
ttcaactgtcaagttgctcagtatccgtttgaagaccataacccaccacagctggagctg
atccgaccgttctgtgaagacctggaccagtggctcagagaggacgagcaccacgtcgca
gccattcactgcaaagcgggaaaaggtcgcactggggtcatgatttgcgcgtacttgttg
caccgtggaaggttccaggaagcgcaggacgcactggatttctacggcgaagttcgcacg
catgacaagaagggcgtgaccatccccagtcagcgccggtacgtgatctactacagctgc
ctgctgaggaaccagctgcagtacaaacccgtggctctgctcttccacaagatgctgttc
gagaccgtccccatgttcaccgccggcacctgcagtaagactgcgcccactgcaccacgc
accacacaccacacaaacctcgacacacagacacccaaccgtctgactgtgtggctgtgc
tctgctgcagatcctcagtttgtggtctaccagctgaaggtgaagatccacacctccaac
cccacccacacacgcagggaagacaaggtcatgctgtttgagtttccgcagccacttcct
gtgtgtggtgacatcaaggtggagtttttccacaagcagaacaagatgatgaagaaggag
aaaatgtttcatttctgggtcaacaccttcttcatccctggaccagaggagaaccaggag
aaactggagaatggcagcacgggggcgctgcgggacacgaccaacaggacacaccagaat
ccagggctagtgacaagtgcaatgacgagtgtagacggcaacgaccgagacttcctggtc
ctcactctgaacaagaacaacttggacaaagccaacaaggacaaggccaacaggaacttc
tcgcccaactttaaggtgaagctgttctttacaaagacggtggaggaaggagctaactgt
gacgccagcagcacgtcagcctccgtgaccccggacgtcagcgacaacgagccggatcac
taccgctactccgacacaacagactcggacccggagaatgagctgtgtgacgacgacgac
cacgaccagatcacgaaagtctga

KEGG   Cynoglossus semilaevis (tongue sole): 103387686
Entry
103387686         CDS       T04866                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04115  p53 signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04218  Cellular senescence
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103387686
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103387686
   04070 Phosphatidylinositol signaling system
    103387686
   04150 mTOR signaling pathway
    103387686
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103387686
  09143 Cell growth and death
   04115 p53 signaling pathway
    103387686
   04218 Cellular senescence
    103387686
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103387686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103387686
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103387686
    3.1.3.48  protein-tyrosine-phosphatase
     103387686
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103387686
Protein phosphatases and associated proteins [BR:csem01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103387686
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 103387686
NCBI-ProteinID: XP_008320666
UniProt: A0A3P8WL49
LinkDB
Position
12
AA seq 445 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRRKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKQQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPTTQGFKKGNWNWDPQFVV
YQLKVKIHTSNPAHTRREDKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESVDKMENGAVNNAESQQGGVGQGQQQPQLQMQPLRNESRDSCRDSDRDYLIL
TLTKNDLDKANKDKANRYFSPNFKVKLYFTKAVEEPSNSEPSTSTSVTPDVSDNEPDHYR
YSDTTDSDPENEPFDEEQHTQITKV
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagccggaacaaaaggagatatcaagaggacggc
ttcgacttggacttaacatatatctacccaaacatcattgctatgggctttccagcagag
agacttgaaggcgtgtacagaaacaatatagatgatgtagtacggtttttggattcaaag
cataaaaaccattacaaaatttacaacctctgcgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtatcccttcgaagaccacaaccctcctcagctggagctc
atcaagccgttttgtgaagacctggaccagtggctcagtgaagacgacaatcatgtggcg
gccatccactgtaaggcggggaagggccgaacaggagtcatgatctgcgcctatctcctc
catcgccgcaaattcatggaggcccaagaagcacttgatttctacggtgaagtcaggaca
agggacaagaagggagtaacgatcccgagccagcgccgttacgtctactactacagccac
ctactgaagcaacagctagagtacaagccggtggcgctcctcttccacaaaatggtgttc
gaaaccctccctatgttcagcgggggcacctgcagggacagtacggttaaaaacaggagc
gagccaaccactcagggcttcaagaaagggaattggaattgggacccccagtttgtggtg
taccagctgaaagtgaagatccacacgtcaaaccctgctcacacgcgccgagaggacaag
cacatgttatttgaattccctcagccgctgcccgtttgtggggacatcaaagtggagttc
ttccataaacaaaacaagatgatgaaaaaggacaaaatgttccacttctgggtgaacacc
ttcttcatccctggaccagaggagagcgtggacaagatggaaaacggggcggtgaacaat
gcagagagccagcagggcggcgtcggacaggggcagcagcagccgcagctacagatgcag
ccgctgcgcaacgagagcagggacagctgcagggacagcgacagggactacctcatcctg
acgctcaccaagaacgacttggacaaggccaacaaagacaaagctaatcgctacttctcg
ccaaacttcaaggtgaagttgtatttcacgaaggccgtggaggagccttcgaactcggag
ccgagcacttcgacatccgtcaccccggacgttagcgacaatgagccagaccattatcga
tactctgacaccactgactctgatccggaaaatgaaccttttgatgaagagcagcacacg
caaatcacgaaagtgtga

DBGET integrated database retrieval system