KEGG   Cynoglossus semilaevis (tongue sole): 103382902
Entry
103382902         CDS       T04866                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103382902
   04068 FoxO signaling pathway
    103382902
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103382902
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103382902
NCBI-ProteinID: XP_008314097
LinkDB
Position
8
AA seq 183 aa
MCIKMSDVRLSNASPTLERVDARQQDNVRPPVRRSLFGKPDPAEIRRSLDDLVQEGVQTL
RDNYNFDPVEDRPLSPRNFEWQEDRNPPEFYVRPPHQRPERDEDSPVESPREDAAERSLQ
PGTNRARKRRSGDLGSCSTESQGAKKSHTDEDDDDDGGGDDEDDGAGSQVLGALQENGSS
VVV
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtgcatcaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagagggtg
gatgcgcggcagcaggacaacgtcagaccgccagtgcgcagaagcctgttcggcaaacct
gatccagcggagatacggaggagtctggatgatttagtgcaagagggagtgcagacgctc
cgggacaactacaacttcgacccggtggaagacagaccgctgagtccgcgcaatttcgag
tggcaggaggatcgaaacccgccggagttttacgtgagaccgccgcaccagcggccagag
agagacgaggactcgcccgtggagagtccgcgggaggatgccgctgagaggagtctccag
ccgggcacgaaccgagccaggaaacgacgctctggagacttaggttcctgctccactgag
tctcagggtgcaaaaaaatcgcataccgacgaagatgatgatgatgatggtggtggtgat
gatgaagatgacggtgcagggagtcaggttttaggagccctgcaggagaatggaagttcc
gtggtcgtgtga

DBGET integrated database retrieval system