KEGG   Pseudoclostridium thermosuccinogenes: CDO33_17935Help
Entry
CDO33_17935       CDS       T05300                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
cthd  Pseudoclostridium thermosuccinogenes
Pathway
cthd00340  Histidine metabolism
cthd01100  Metabolic pathways
cthd01110  Biosynthesis of secondary metabolites
cthd01230  Biosynthesis of amino acids
Module
cthd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CDO33_17935
Enzymes [BR:cthd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CDO33_17935
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CDO33_17935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AUS98165
UniProt: A0A2K2FIQ4
LinkDB All DBs
Position
complement(4105054..4105755)
Genome map
AA seq 233 aa AA seqDB search
MIKNIVDELKFDERGLIPVVTQDNRTDEVLMVAYMNREAFEKSVETGMVHYWSRSRGKLW
LKGETSGHFQRIRSISYDCDGDTLLIKVDQTGAACHTGHHSCFYRKLNIEDVQDGKCQAE
AKPAENPCTFGQPCDDEQKGNLAEVLQEVYNTVTDRKIHPKEGSYTNYLFSKGLDKILKK
VGEEASEVIIASKNGNPNEIKGEIADLLYHLCVLMVERGVKLDDIYEELKSRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatattgtagatgagctgaagtttgacgaaagaggattgataccggtagtt
actcaggataacaggactgatgaggttctgatggttgcatatatgaaccgggaggccttt
gagaagtctgtggaaaccggcatggtccattactggagcaggagcagaggcaaactttgg
ctaaagggtgagacatcaggacatttccagaggatcaggtccataagctatgactgtgac
ggggatacgctgctgataaaggttgatcagaccggagcggcctgtcatacaggacaccac
tcatgcttttatcggaagcttaatatagaggatgtacaggatggcaaatgccaggccgaa
gccaaaccagcggaaaatccctgtacctttggacagccttgtgatgatgagcagaaagga
aacctggcagaagtgcttcaggaggtatataacacggtaacggacaggaagattcatcct
aaggaaggttcctataccaactacctttttagcaaaggactggataagatattaaaaaag
gtaggagaagaagcttcggaagttattattgcatcaaaaaacggaaatcctaatgaaata
aaaggagaaatcgcagacctgctgtatcacctctgcgttttgatggtggaaagaggcgta
aagctggacgacatatatgaagagctcaaaagcagaagataa

DBGET integrated database retrieval system