KEGG   Chaetomium thermophilum: CTHT_0057190Help
Entry
CTHT_0057190      CDS       T03100                                 

Definition
(RefSeq) hexokinase-like protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00010  Glycolysis / Gluconeogenesis
cthr00051  Fructose and mannose metabolism
cthr00052  Galactose metabolism
cthr00500  Starch and sucrose metabolism
cthr00520  Amino sugar and nucleotide sugar metabolism
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01130  Biosynthesis of antibiotics
cthr01200  Carbon metabolism
Module
cthr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cthr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTHT_0057190
   00051 Fructose and mannose metabolism
    CTHT_0057190
   00052 Galactose metabolism
    CTHT_0057190
   00500 Starch and sucrose metabolism
    CTHT_0057190
   00520 Amino sugar and nucleotide sugar metabolism
    CTHT_0057190
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTHT_0057190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cthr04131]
    CTHT_0057190
Enzymes [BR:cthr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CTHT_0057190
Membrane trafficking [BR:cthr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CTHT_0057190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18259757
NCBI-ProteinID: XP_006696040
UniProt: G0SCG9
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MAGDDPKTPPSEKGSGSDADVPKDLAKEIKYIEELFTVDTAKLKQITDHFVKELEKGLSV
EGGSIPMNPTWVMGFPTGHETGTFLALDMGGTNLRVCQVTLTDQQSEFDIIQSKYRIPPP
LKTGTAEELFEYIADCLLQFIQTHHDDLSQIGRMPLGFTFSYPATQNYIDEGILQRWTKG
FDIEGVEGKNVVPMFEAALARRGVPIRLAALINDTTGTLIASAYTDPKMKIGCIFGTGCN
AAYMEDCGSIPKLAHLNLPPETPMAINCEWGAFDNEHKVLPRTPYDITIDEDSPRPGQQA
FEKMIAGLYLGEIFRLTLVDLHDNHDRRVFVGQDITKLRKPYTLDTSFLSAIEEDSDENL
SDIAGLFQNKLNITPNKAERILIKRLAELIGTRAARLSACGVAAICKKKGYKECHVGADG
SVFNKYPHFKERGAQALREILDWGEKKDPKEEDPIEILAAEDGSGVGAALIAALTLERVQ
KGNLHGILHPENYV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgacgatcccaagacgccgccctcggagaagggctctggctccgacgccgat
gtgcccaaagaccttgcgaaggagatcaagtacatcgaggagctgttcaccgtcgacacg
gccaagctgaagcaaattaccgaccattttgtgaaggaactcgagaagggcctgagcgtt
gagggtggcagcattcccatgaacccaacctgggtgatgggattccctactggtcatgag
acaggcaccttcttggcgctcgatatgggcggcaccaacttgcgtgtatgccaggtgacc
ctgaccgatcagcagtccgagttcgacatcatccagtccaagtaccggatccctcccccg
ctgaagacgggcacagctgaggagctattcgagtacatcgccgactgcctgctgcagttc
atccagactcatcacgacgacctgtcccaaatcggccgcatgcccctgggcttcaccttc
tcgtatcctgcgacccaaaactacattgacgagggtatcctacagcgctggaccaagggc
ttcgacatcgagggcgtcgagggcaagaatgtggtccctatgtttgaggctgctcttgct
cgacggggcgtccccatccggctggccgccttgatcaacgatacgacgggcacgctgatt
gcctcggcatacaccgaccctaagatgaagattggctgtatctttggcacaggctgcaac
gccgcgtacatggaggactgtggttccatccccaagttggcacacctcaaccttcctccc
gaaacccccatggccattaactgtgagtggggcgccttcgacaacgagcacaaggtgctg
ccgcgcactccgtacgacattaccattgatgaggactcgccgcgtccgggccagcaggcc
tttgagaagatgattgccggcctgtacctcggcgagatcttccgtctgacgctggtcgat
ctgcatgataaccatgatcggcgtgtctttgttggccaggacataaccaagttgcgtaag
ccgtataccttggacacgtccttcctgtcagccattgaggaggactcggacgaaaacctc
tccgacatagcgggcctcttccagaacaaactcaacatcacccccaacaaggccgagcgc
atcctgatcaagcgcctagctgagctgatcggcacccgagcggcgcgcctctccgcctgc
ggcgtggcagccatctgcaagaagaagggctataaagaatgccacgtgggcgccgacggc
tccgtcttcaacaagtacccgcacttcaaggagcgcggcgcgcaggccctgcgcgagatc
ctcgactggggagagaagaaggatcctaaggaggaggatcccatcgagattctcgctgct
gaagacggcagcggtgtgggcgccgcgctaattgccgcgctgacgctggaacgggtacag
aaggggaatttgcatgggattttgcacccggagaattatgtctag

DBGET integrated database retrieval system