KEGG   Cyprinodon variegatus (sheepshead minnow): 107082800
Entry
107082800         CDS       T06110                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04137  Mitophagy - animal
cvg04210  Apoptosis
cvg04218  Cellular senescence
cvg04620  Toll-like receptor signaling pathway
cvg04621  NOD-like receptor signaling pathway
cvg04622  RIG-I-like receptor signaling pathway
cvg04623  Cytosolic DNA-sensing pathway
cvg04625  C-type lectin receptor signaling pathway
cvg04920  Adipocytokine signaling pathway
cvg05132  Salmonella infection
cvg05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107082800 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107082800 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    107082800 (rela)
   04218 Cellular senescence
    107082800 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107082800 (rela)
   04621 NOD-like receptor signaling pathway
    107082800 (rela)
   04622 RIG-I-like receptor signaling pathway
    107082800 (rela)
   04623 Cytosolic DNA-sensing pathway
    107082800 (rela)
   04625 C-type lectin receptor signaling pathway
    107082800 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107082800 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107082800 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107082800 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107082800 (rela)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107082800 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107082800
NCBI-ProteinID: XP_015227150
Ensembl: ENSCVAG00000023334
UniProt: A0A3Q2EL51
LinkDB
Position
Unknown
AA seq 622 aa
MDGVYGWGLTPLNPVQTANPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFKIPEPKVWEEEFDLNSVRLCFQASFSLPTGERFSLEPVV
SQPIFDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIKVKMQLRRPSDREVSEPMDFQYLPADPDEYRLS
EKRKRTGDMFQSLKLGSMLSTVPVSQERRQINQARRTVPAKLPLMNTQAVAEVSASSSGM
KTQTPFSYGQPGHLFLPKAEASSSVPSATSQTWKMMDSLKLGPQPKPNPAPTFTMSSASG
SSSSTTTTTSSTANQDYSTVNLSDLHEFFPNISSTMAQESAAPQGAPSQTGGSFPLQEQQ
FRVEAPLADDDIPEFPSFSDAQVPGTLDSLNMDDFEDLLNPAPATSMLSSSHHGGLSGSA
QSSAASQNPSDSVSNPGSTYMNYPNSIANLLRSEDMIVLASNNNQQPTVLDDLDVLMSAD
EERLISIFNSGSQPGFVSGHPT
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggacggtgtgtatggatggggcttgacccctctaaacccagtccaaactgcgaaccct
tacatagagatcatcgagcagcccaagcagagggggatgaggtttcggtataaatgcgaa
ggccgctcggccggcagcattccaggagagaagagcaacgacaccactaagacctacccg
gccatcaaggttcacaactacagcggtcccctccgggtccgcatctcgcttgtgacaaag
aacccgccgtacaagccccacccccacgagctggtcgggaaagactgcaaacatggctac
tatgaggccgacctgcaggagagacgcattcacagttttcagaacctgggcatccagtgt
gtgaagaagaaggatgtaaatgaggccatcacttgtagactgcagaccaacaacaatcca
tttaaaattcctgagcccaaggtgtgggaggaagagtttgatctgaactctgtgcggctt
tgcttccaggcctccttctccctgcccaccggggagcgattttctctggagcctgtggtc
tcgcagcccatctttgacaatagagccccgaacacggccgagttaaagatctgcagggtg
aaccgaaactctgggagctgcaaagggggggacgagatcttccttctctgtgacaaagtg
caaaaagaggacatcgaggttcgcttcttccaggactcgtgggaggggaagggcaccttc
tctcaggccgacgtccaccggcaggtggccatcgtgttccgcactcctccctatcgcgac
actaacctcagcgagcccatcaaggtgaagatgcagctcagacggccctcggaccgggag
gtcagcgagcccatggacttccagtacctacctgccgacccagatgaatacaggctgagt
gagaagaggaagcggacgggcgacatgttccagagcctgaagctgggatccatgttatct
accgtgcctgtttcacaagagaggcggcagatcaaccaggcgcggagaacagtccccgct
aagctgcccttaatgaacacacaagcagttgctgaggtgtccgccagcagcagtgggatg
aaaacccagacccccttctcgtacggccaaccgggccacctgtttttacccaaggcggag
gcgtcttcatccgtcccttcggcaacaagccaaacatggaagatgatggacagtttgaag
ctgggccctcagcccaaacccaacccggcccccaccttcaccatgagctcagcgtcgggc
tcctcctcctctaccaccaccaccacctcctccacagccaaccaggactactctacggtt
aacctgtcagaccttcacgagttcttccccaacatctcctctaccatggcccaggagtcc
gcggctcctcagggggccccctcacaaaccgggggctccttccccctgcaggagcagcag
ttcagagtggaggccccgctggcagacgacgacatcccggagttccccagcttctccgac
gcccaggtccccggcaccctggacagcctaaacatggatgattttgaggaccttctgaac
cctgcgcccgctacgtccatgctatcctcctcccaccacgggggcctctccggctccgcc
cagagcagcgctgcatcccagaacccctccgactccgtcagcaacccaggaagcacctac
atgaattaccccaacagcatcgctaacctgctccggagcgaggacatgatcgtcttggcg
tccaacaacaaccagcagcccacggtgctggacgacttggacgtcctgatgtctgccgac
gaagagcgcctcatttccatttttaacagcgggagccaacccggcttcgtgtcaggacac
ccgacctaa

DBGET integrated database retrieval system