KEGG   Daucus carota (carrot): 108221827Help
Entry
108221827         CDS       T05350                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00904  Diterpenoid biosynthesis
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    108221827
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dcr00199]
    108221827
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     108221827
Cytochrome P450 [BR:dcr00199]
 Cytochrome P450, plant type
  CYP701 family
   108221827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108221827
NCBI-ProteinID: XP_017251171
LinkDB All DBs
Position
5
AA seq 514 aa AA seqDB search
MDLVVNMQSTPMVNALAIGGPAVAVGGLSLLLIKKFVDHHWKSAPDLPQVPGLPIIGNLL
QLKEKKPHKTFAKWAVTYGPVYSIRTGSTTLVVLNSAEVAKEAMVTRFPAISTRKLSKAV
DILACDKSLVAISDYDEFHKTTKRHLLTHILGPSAQKGQRFHRDSLIENVSNQLHALSKN
CPLESINFRELFELGLFGLALKQTLGEDVESIYVDELGTTMSRHEMLKCLVHDPMVGGID
VDWRDFFPYLKWIPNRGFENRIRQMDIRRMAVMKSLVQRARKQIASREGVQCYLNYLDSE
GKTLSEKQILVLLWEVIIETSDTTVVATEWALYELAKDLKRQERLYEEISRVCGSDRITE
EKLPQLPYLYAIFQETLRVHSPVPIIPLRYVHEDTQIGGYFVPSGSEIAINIYGCNMDKN
VWENPEQWNPERFLDETSDTMELQRTMAFGGGKRVCAGALEAMTISRMAIGRLIQEFQWS
LTDDQADDVDIVGLTARKLQPLLAILKPRGRLFE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggacttggttgtgaacatgcaatcaacacctatggttaatgcacttgcgataggtggt
cctgctgttgctgttggtggtctttcacttttgttgatcaaaaaatttgtcgatcatcac
tggaaatccgctccggatctccctcaggtaccagggttgccaataatcggaaatctgctg
cagttgaaagagaagaaaccgcacaagacatttgcgaagtgggctgtcacatatggccct
gtttactctattagaactggatccaccactttagttgtactcaattctgctgaagtggcc
aaagaggccatggtgacaagatttcctgccatctctactagaaagctttcaaaggcagta
gatatccttgcttgtgataaatcactggttgctataagtgattacgacgagttccacaag
actacaaagaggcatttactaacacatattttggggccaagtgctcagaaggggcaacgt
ttccacagagatagtttgattgagaacgtatcgaaccagttgcatgccttgtcaaagaat
tgtcctcttgagagtataaacttcagagaactgtttgaacttggactctttggattagca
ttgaaacaaactttgggagaggatgtggagtccatttatgtggatgaacttggaacaaca
atgtcaaggcatgagatgttaaagtgtctagttcatgatccaatggtgggtggaattgat
gtagattggcgagacttcttcccatatctaaaatggattccaaatagagggtttgaaaac
agaatcagacagatggatatccgaaggatggcagttatgaaatcccttgttcagagagct
agaaaacaaattgcttcaagagagggcgtgcagtgttatcttaattacttggattctgag
gggaaaacgctatcagaaaaacagattcttgtcttactttgggaggtgatcattgaaaca
tcagatactaccgtggttgcaactgaatgggctttatatgaacttgctaaagacttaaag
cggcaggagaggctttatgaggagatcagtagggtctgcgggtctgacagaatcacagag
gagaagttaccgcagcttccttatctttatgctatcttccaagagactctgagagttcac
agtcctgttccaataattcctctgcgttatgtgcatgaagatactcaaattggaggttac
tttgttccttctggaagcgagattgccataaatatttacggatgtaacatggacaagaat
gtgtgggagaatcctgaacagtggaaccctgagagattcttggatgaaacatctgacacc
atggaattgcaaaggacaatggcctttggagggggtaagagagtgtgtgcaggagctctc
gaggcaatgacaatctcccgtatggcaattggcagactaatacaagagtttcagtggagt
ttgacggatgatcaggcagatgatgttgatattgtaggccttacagctcgcaaactccaa
ccactgctcgcgatcttgaagccaaggggcagattgtttgaataa

DBGET integrated database retrieval system