KEGG   Dendronephthya gigantea (soft corals): 114528931
Entry
114528931         CDS       T06112                                 

Definition
(RefSeq) uncharacterized protein LOC114528931
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dgt  Dendronephthya gigantea (soft corals)
Pathway
dgt04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dgt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114528931
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114528931
NCBI-ProteinID: XP_028406444
LinkDB
Position
Unknown
AA seq 165 aa
MSDRRGANVRRRLFDDSATNEGCEQLNNINGDEGNEQLLDRKQEEWNFDFRNGHPLPGRY
AWQAVENSSLAESSFTPITSRGRTRASNNESIGSARHTTSTRQDTSRIAETSTSRYSPYN
LRSRSRGGRNSNERGFLPIGYTNRDRSSSRSSNTSNERLEGDVRT
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagcgataggagaggtgccaacgtccgccgaaggttgtttgacgattcagcaacgaac
gagggctgtgaacagttgaacaatataaatggcgacgaaggcaacgaacagcttctggat
cgcaagcaagaagaatggaactttgattttcgaaacggtcatcctttaccaggccgttat
gcgtggcaggcagttgagaacagttcactagcagaatctagttttacaccaataacatcc
agaggcagaacaagagcaagcaacaatgaatcaattggaagtgcaagacatacaacatct
acaagacaggatacaagcaggattgcagagactagcacgagcagatattcaccgtataac
ctaagaagccggtcgagaggaggacgtaatagcaatgaaagaggatttctcccaatagga
tatacaaacagagatcgaagcagttctagatcatcaaacacatcaaatgaaagacttgag
ggcgacgttaggacatga

DBGET integrated database retrieval system