Dietzia sp. oral taxon 368: C3V38_08910 Help Entry C3V38_08910       CDS       T05390                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism dit  Dietzia sp. oral taxon 368 Pathway dit00790   Folate biosynthesis dit01100   Metabolic pathways dit01240   Biosynthesis of cofactors Module dit_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:dit00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     C3V38_08910 (folB) Enzymes [BR:dit01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      C3V38_08910 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      C3V38_08910 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      C3V38_08910 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB RII_binding_1 Motif Other DBs NCBI-ProteinID:  AVM65856 UniProt:  A0A2S0M033 LinkDB All DBs Position 1904661..1905056 Genome browser AA seq 131 aa AA seqDB search MADRIELRGLKVRGNHGVFDHEKRDGQDFLVDLVLWTDFTAATASDDLADTVDYGALALF ARDVVAGPSYDLIETVASRIADGVMEMAPDAHAVEVTLHKPQAPIPAEFADVAVVARRSR GGRSHHERGER NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggccgaccgcatcgaactccgcggactgaaggtgcgcggcaaccacggggtcttcgac cacgagaagcgggacggccaggatttcctcgtggatctggtcctgtggaccgacttcacc gccgcgaccgcctccgacgacctggccgacacggtcgactacggcgcactcgcgctgttc gcgcgcgatgtcgtcgccgggccgtcctacgacctcatcgagacggtggcctcgcggatc gccgacggcgtcatggagatggcacccgacgcccacgcggtggaggtgacgctgcacaag ccgcaggcccccatcccggccgagttcgccgacgtcgccgtcgtggcacggcgctcccgc ggcggcaggagccaccacgagcggggcgagcggtga

DBGET integrated database retrieval system