KEGG   Delphinapterus leucas (beluga whale): 111182530
Entry
111182530         CDS       T05885                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor isoform X2
  KO
K08523  heparin-binding EGF-like growth factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01522  Endocrine resistance
dle04012  ErbB signaling pathway
dle04912  GnRH signaling pathway
dle04915  Estrogen signaling pathway
dle04928  Parathyroid hormone synthesis, secretion and action
dle05171  Coronavirus disease - COVID-19
dle05205  Proteoglycans in cancer
dle05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111182530 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111182530 (HBEGF)
   04915 Estrogen signaling pathway
    111182530 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    111182530 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111182530 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    111182530 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111182530 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111182530 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111182530 (HBEGF)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111182530 (HBEGF)
SSDB
Motif
Pfam: EGF Ninjurin NdhL
Other DBs
NCBI-GeneID: 111182530
NCBI-ProteinID: XP_022444660
UniProt: A0A2Y9PFK7
LinkDB
Position
Unknown
AA seq 208 aa
MKLLSSVVLKLLLAAVLSALVTGDSLERLRRGLAAGTSNLDSPTQSTDQLLPPGGGRGRE
VLDLEETDLDLFRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHLGYHGERCHGLSLPVKNRLYTYDHTTILVVVVVVLSSVCLLVIVG
LLMFWYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgtcgtcggtggtgctgaagcttcttttggctgcagtgctctcggcgttg
gtgaccggcgacagcctggagcggcttcgaagagggctggcggctggaaccagcaatctg
gactcccctactcaatctacggaccagctgctgcccccgggaggtggccgaggccgggaa
gtcctggacttggaagagacagacctggaccttttcagagctgctttctcttccaagcca
caagctctggccacaccgagcaaggaggagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccatcctgcatctgccacctgggttaccatgga
gagaggtgccatgggctgagcctcccagtgaaaaatcgtttatatacctatgatcacacg
accatcctggttgtggtggtcgtggtgctgtcatccgtctgtctgctggtcatcgtgggg
cttctcatgttttggtaccacaggagaggaggttatgacgtggaaaatgaagagaaagtg
aaattgggtatgactacgtcccactga

DBGET integrated database retrieval system