KEGG   Delphinapterus leucas (beluga whale): 111183086
Entry
111183086         CDS       T05885                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04072  Phospholipase D signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04510  Focal adhesion
dle04540  Gap junction
dle04630  JAK-STAT signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05165  Human papillomavirus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05214  Glioma
dle05215  Prostate cancer
dle05218  Melanoma
dle05230  Central carbon metabolism in cancer
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111183086 (PDGFRB)
   04014 Ras signaling pathway
    111183086 (PDGFRB)
   04015 Rap1 signaling pathway
    111183086 (PDGFRB)
   04630 JAK-STAT signaling pathway
    111183086 (PDGFRB)
   04020 Calcium signaling pathway
    111183086 (PDGFRB)
   04072 Phospholipase D signaling pathway
    111183086 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    111183086 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111183086 (PDGFRB)
   04540 Gap junction
    111183086 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111183086 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183086 (PDGFRB)
   05206 MicroRNAs in cancer
    111183086 (PDGFRB)
   05230 Central carbon metabolism in cancer
    111183086 (PDGFRB)
   05231 Choline metabolism in cancer
    111183086 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    111183086 (PDGFRB)
   05218 Melanoma
    111183086 (PDGFRB)
   05215 Prostate cancer
    111183086 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111183086 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111183086 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111183086 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dle04090]
    111183086 (PDGFRB)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111183086 (PDGFRB)
Protein kinases [BR:dle01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111183086 (PDGFRB)
CD molecules [BR:dle04090]
 Proteins
  111183086 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 111183086
NCBI-ProteinID: XP_022445809
UniProt: A0A2Y9PKM4
LinkDB
Position
Unknown
AA seq 1103 aa
MRPPSAMRAPVLEGQVLLLPLLLLLGPPASWGLVITPPGPELVLNLSSTFVLTCSGPAPV
VWERMSQKPPQEMTTSQDGTFSSVLTLTNVTGLDTGEYFCTYKGSHGLEASERKRLYIFV
PDPTVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVTLHEKKVDVPLPIAYDYQRGFS
GTFEDKTYVCKTTIGDREVDSDAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSESVSDHR
DEKAINVTVVESGYVRLLGELDPVQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLGDSG
AGEVALSTRNVSETRYVSELTLVRVKVAEAGRYTMRAFHEDAEAQLSFQLQVNVPVRVLE
LSESHPASGEQTVRCRGRGMPQPHLSWSTCSDLKRCPLELPPTPLGNSSEEESLLETNVT
YWAEEQEFEVVSTLRLRRVDQPLSVRCTLHNLLGQDVQEVTVVPHSLPFKVVVISAILAL
VVLTIISLVVLIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLGHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIFIITEYCRYGDLVDYLHRNKHTFLQRCSNKRRPPSAELYSNALP
VGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPS
APERTCRVTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFNGLRSPLDTSSVLYTAVQPNEGDNDY
IIPLPDPKPEVAVEGPLEGSPSLASSALNEVNTSSTISCDSPLEPQEEPEPEPQPESQVE
PEPKRPPDSSCPGPRAEAEDSFL
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgcggcctccgagtgccatgcgagctcctgtcctcgaaggccaggtgctgttgctgccc
ttgctgttgttgctgggaccaccggcctcctggggcctggtcatcacacccccggggcca
gagcttgtcctcaatctctccagcacctttgttctgacctgctcgggtccagctccagtg
gtgtgggaacggatgtcccagaagcccccacaggaaatgaccacgagccaggacggcacc
ttctccagtgtgctgacactgaccaatgtcactgggctagacacaggagaatacttttgt
acctacaaaggctcccatgggctggaggccagcgagcgaaaacgactctacatctttgtg
ccagatcccactgtgggcttcctccctgttgaccccgaggaactattcatctttctcacg
gaaataaccgagaccacaattccatgccgagtgacggatccgagactggtggtgacgttg
catgagaagaaggtggatgtcccgctgcccatcgcctatgactaccaacgtggcttctct
ggtacctttgaggacaagacctacgtctgcaaaaccaccatcggggacagggaggtggat
tcggatgcctactatgtctacagcctccaggtgtcatccatcaacgtctcagtgaatgcg
gtgcagactgtggtccgccaaggggagaacatcaccatcatgtgcattgtgactgggaat
gaggtggtcaactttgagtggacatacccacgcatggagagtgggcggctggtggagcca
gtgaccgacttcctctttgaaatgccccacatacgttctatcctgcacatccccagtgcc
gagctgggagactcagggacctacatctgcaatgtatcagaaagtgtgagcgaccatcga
gatgaaaaggccatcaatgtcaccgtggtcgagagcggttacgtgcggctgctgggagag
ctggaccctgtacaattcgcggagcttcaccgcagccggaccctgcaggtggtgttcgag
gcctacccgccgcccactgtcatgtggttcaaggacaaccggaccctgggtgactccggc
gccggcgaggttgcgctgtccacgcgcaatgtgtctgagacccggtacgtgtcagaactg
acactggtgcgggtgaaggtggctgaagctggccgctacaccatgcgggccttccatgag
gatgctgaagcccagctctccttccagctgcaggtcaacgtgcctgtccgtgtgctggag
ctgagcgagagccaccctgccagcggggagcagacagtccgctgtcgtggccggggcatg
ccccagccacacctcagctggtctacctgcagcgacctcaaaaggtgtccgctggagctg
cctcccacgccactggggaacagttccgaggaggagagcctgctggagacgaacgtgaca
tactgggcagaggagcaggagttcgaggtggtgagcacactgcgcctgcgccgtgtggat
cagccgctgtccgtgcgctgcacgctgcacaacctcctgggccaagacgttcaggaggtc
accgtggtgccacattccttacccttcaaggtggtggtcatctcggcaatcctggccttg
gtggtgctcacgatcatctccctcgtcgtcctcatcatgctctggcagaagaagccacgc
tatgagatccgatggaaagtgattgaatctgtgagctctgatggccatgaatacatctac
gtggaccctatgcagctgccttacgactccacctgggagctgccgcgggaccagcttgtg
cttggacgcaccctgggctccggggcctttgggcaggtggtggaggccacggctcacggc
ctgggccattcgcaggctaccatgaaagtggccgtcaagatgctgaaatccacagcccgc
agcagcgagaagcaagccctcatgtcggagctgaagatcatgagtcacctcgggccccac
ctgaacgtggtcaacctgctgggggcctgcactaaaggagggcccatcttcatcatcacc
gagtactgccgctacggcgacctggtggactacctgcaccgcaacaagcacacctttcta
cagcgctgctccaacaagcgccgcccgcccagtgctgagctctacagcaacgccctgccc
gttgggctcccgctgcccagccatgtgtccctgcctggggagagcgatggtggctacatg
gacatgagcaaagatgagtcagtggactacgtgcccatgctggacatgaaaggggacgtc
aaatacgcagacatcgagtcctccaactacatggctccttatgataactacgtcccctcc
gctcctgagaggacctgccgggtgactttaatcaacgagtccccagtacttagctacacg
gatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaagaat
tgcgtccaccgagatctggcagccaggaatgtgctcatctgtgagggcaaactggtcaag
atctgcgactttggcctggctcgtgacatcatgcgggattcaaactacatctccaaaggc
agtaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctctacacc
accctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccctgggtggc
accccgtacccagagctgcccatgaacgagcagttctacaatgccatcaagcggggctac
cgcatggctcagcctgcccacgcctctgacgagatctatgagatcatgcagaagtgctgg
gaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagagactg
ctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgac
cacccagctgtccttcggtcccaagcccgcttgcccggcttcaatggcctccgatccccc
ctggacaccagctccgtcctctacactgctgtgcagcccaacgagggtgacaacgactat
atcatccccctgcctgaccccaaacccgaggttgctgttgagggaccactggagggttcc
cccagccttgccagctccgccctgaatgaagtcaacacctcctcaaccatctcctgtgac
agccccctggaaccccaagaggaaccagagccagagccccagcctgagtcccaggtggag
ccagagcccaagcggccgccggattccagctgccctgggcctcgggccgaggcggaggac
agcttcctgtag

DBGET integrated database retrieval system