KEGG   Delphinapterus leucas (beluga whale): 111183629
Entry
111183629         CDS       T05885                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04217  Necroptosis
dle04620  Toll-like receptor signaling pathway
dle04621  NOD-like receptor signaling pathway
dle04622  RIG-I-like receptor signaling pathway
dle04657  IL-17 signaling pathway
dle04668  TNF signaling pathway
dle05010  Alzheimer disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05132  Salmonella infection
dle05142  Chagas disease
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    111183629 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111183629 (FADD)
   04215 Apoptosis - multiple species
    111183629 (FADD)
   04217 Necroptosis
    111183629 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111183629 (FADD)
   04621 NOD-like receptor signaling pathway
    111183629 (FADD)
   04622 RIG-I-like receptor signaling pathway
    111183629 (FADD)
   04657 IL-17 signaling pathway
    111183629 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183629 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111183629 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    111183629 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111183629 (FADD)
   05152 Tuberculosis
    111183629 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111183629 (FADD)
   05161 Hepatitis B
    111183629 (FADD)
   05160 Hepatitis C
    111183629 (FADD)
   05164 Influenza A
    111183629 (FADD)
   05162 Measles
    111183629 (FADD)
   05168 Herpes simplex virus 1 infection
    111183629 (FADD)
   05163 Human cytomegalovirus infection
    111183629 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111183629 (FADD)
   05169 Epstein-Barr virus infection
    111183629 (FADD)
   05165 Human papillomavirus infection
    111183629 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111183629 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111183629 (FADD)
SSDB
Motif
Pfam: DED Death tRNA_NucTran2_2 ZapA
Other DBs
NCBI-GeneID: 111183629
NCBI-ProteinID: XP_022446851
UniProt: A0A2Y9PNL8
LinkDB
Position
Unknown
AA seq 211 aa
MDPFLVLLHSVSTGLSSSELTELKFLCQSRVGKRKLERVQSGLDLFSVLLEQNEMSPENT
VLLRELLVSLRRQDLLRRLDDFEAGAAGGAAPEERDLRAAFDIICDNVGKDWRKLARHLR
VSDAKIEAIEEKYPRNLAEQVRESLRVWKNSRRDDAAVSHLVRALRACRLNLVADLIEEG
QRARALQNESGDPVSLSESWDSDSPASGASR
NT seq 636 nt   +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgaccggcctgtcgagcagcgagctg
actgagctcaagttcctgtgtcaaagccgcgtgggcaagagaaagctggagcgcgtgcag
agtggcctggacctcttctccgtgctgctggagcagaacgagatgagccccgagaacacc
gtgctgctccgcgagctgctcgtctccctgcggcgccaggacctcctgcggcgcctggac
gacttcgaggcgggcgcggcgggcggggccgcgccggaggagcgagacctgcgggcagcg
tttgacatcatctgtgataacgtggggaaggactggaggaaactggctcgtcacctcaga
gtgtctgacgccaagattgaagccattgaggagaagtatccccggaacctggcagaacag
gtgagggagtcgctgagagtctggaagaacagcaggagggatgatgcggccgtgtcccac
ctggtgagggcgctcagggcctgccggctgaacctggtggcagacctcatcgaggagggt
cagcgggcccgggccctccagaacgagagtggggaccctgtgtcactctctgagtcctgg
gactcagactcgcctgcctcaggggcctcccgatga

DBGET integrated database retrieval system