KEGG   Delphinapterus leucas (beluga whale): 111187821
Entry
111187821         CDS       T05885                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04115  p53 signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle05010  Alzheimer disease
dle05012  Parkinson disease
dle05014  Amyotrophic lateral sclerosis
dle05016  Huntington disease
dle05020  Prion disease
dle05022  Pathways of neurodegeneration - multiple diseases
dle05134  Legionellosis
dle05152  Tuberculosis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05164  Influenza A
dle05168  Herpes simplex virus 1 infection
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111187821 (APAF1)
   04215 Apoptosis - multiple species
    111187821 (APAF1)
   04115 p53 signaling pathway
    111187821 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187821 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    111187821 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111187821 (APAF1)
   05012 Parkinson disease
    111187821 (APAF1)
   05014 Amyotrophic lateral sclerosis
    111187821 (APAF1)
   05016 Huntington disease
    111187821 (APAF1)
   05020 Prion disease
    111187821 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    111187821 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111187821 (APAF1)
   05152 Tuberculosis
    111187821 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    111187821 (APAF1)
   05160 Hepatitis C
    111187821 (APAF1)
   05164 Influenza A
    111187821 (APAF1)
   05162 Measles
    111187821 (APAF1)
   05168 Herpes simplex virus 1 infection
    111187821 (APAF1)
   05169 Epstein-Barr virus infection
    111187821 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111187821 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like eIF2A CARD_2 Utp8 AAA_16 Hira ATPase_2 AAA_18 AAA_22
Other DBs
NCBI-GeneID: 111187821
NCBI-ProteinID: XP_022455575
UniProt: A0A2Y9QDI9
LinkDB
Position
Unknown
AA seq 1248 aa
MDAKARNCLLQHREALERDVKTSYIMDHMISDGVLTVSEEEKVKNEPTQRQRAAMLIKTI
LEKDNYSYISFYNALLHEGYKDLAYLLHGGIPVLSSSNGKDSVGITSYVRTVLCEGGVPQ
RPVVFVTRRKLVNAIQQKLFKLSGEPGWVTIYGMAGCGKSVLAAEAVRDHSFLEVCFPGG
VHWVSVGKQDKSGLLMKLQNLCTRLDQDENFSQRLPLNIEEAKDRLRILMLRKHPRSLLI
LDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESGLGKEKGLEILSLFVNM
KKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPTRWEYYLRQLQNKQFKKIRKSSSYDY
EALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNK
SLLFCDRNGKSFLYYLHDLQVDFLTQKNHSQLQDLHKKLITQFQRHFRLHCLSPDQEDCM
YWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHMLDEKDGAVC
ENFQEFLSLNGHLLGRQPFPNIVQLGLCELETSEVYQQAKLKAKQEVDNGMLYVEWINKE
NIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKNLQVFKAETGEKLLEIKAHEDEVL
CCAFSADDRFIATCSVDKKVKIWNSTSGELVHTYDEHSEQVNCCHFTNNSNHLLLATGSD
DCFLKLWALNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERKSI
NVKQFFLNSEEPQEDMEVIVKCCSWSADGARIMVAAKNKVFLFDIHTSGLLAEIHTGHHS
TVQYCDFSPHNHLAVVALPQYCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLTSS
DDQTIRLWETKKVCKNSAIALKQEIDVVFQENEVMVLAVDDIKRLQLLNGNTGQIEYLTE
AQVSCCCLSPHLQYLAFGGEDGAIRILEILNNRIFQSRTGHKNTVRHIQFTADAKTLISS
SDDSAIQVWNWQSEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGRIEKDF
VCHQDTVLSCDISPDATKYSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSAFSVDSTL
LATGDDNGEIRIWNVSNGELLHLFAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGYLK
WWNVVTGESSQTFYTNGTNLKEIHVSPDFKTYVTVDNLGILYILKILE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagccctggaaagggacgtc
aaaacatcctacatcatggatcacatgattagtgatggagttttaacagtgtcggaggag
gaaaaagtaaaaaatgagcccacccaacggcaacgagcagctatgctaattaaaacgata
cttgaaaaagataattattcctatatatcattctacaatgctctgctacatgaagggtat
aaagatcttgcctaccttctccatggtggcattcctgtcctatcttcttccaatggcaaa
gattcagttggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtaccacag
aggcccgttgtttttgttactaggaggaagctagtgaatgcaattcagcagaagctcttc
aaactgagtggtgaaccgggatgggtcaccatatacggaatggcaggttgtgggaagtct
gtattagctgcagaagctgttcgagatcattctttcttagaagtttgtttcccagggggt
gtgcattgggtttcagttgggaaacaagacaaatctgggcttctgatgaaactgcagaat
ctttgcacacggctggatcaggatgagaatttctcccagaggcttccacttaatattgaa
gaggctaaagaccgtctccgcattctgatgctgcgcaaacatccaaggtctctgttgatt
ttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcagtgtcagattctt
cttacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgtagtccct
gtggagagtggtttaggaaaagaaaaaggacttgaaattttatccctttttgttaatatg
aagaaagcagatttgccagaacaagctcacagtattataaaagaatgtaaaggttcacct
cttgtagtgtctttaattggtgcacttttacgagattttcccacccgctgggagtactac
ctcaggcaacttcagaataagcaatttaagaagataaggaaatcttcatcttatgattat
gaggctttggatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaagat
tattacacagatctttccatccttcagaaagatgttaaggtgcctacgaaggtgttgtgt
atcctctgggatatggaaactgaagaagttgaagacatactgcaggagtttgttaataag
tctctcttgttctgtgatcgaaatggaaaatcatttctttattatttacatgatcttcaa
gtagatttccttacacagaagaatcacagccagcttcaggatctacacaagaaactaatc
actcagttccagagacatttccggctacattgtctttcaccagatcaggaggactgcatg
tattggtacaattttctggcctatcacatggctagtgctaaaatgcacaaagaactgtgt
gctttaatgttttccctggattggattaaagcaaaaacggagctcgtaggccctgctcat
ctgattcatgaatttgtggaatacaggcatatgttggatgaaaaggatggtgcagtctgt
gagaatttccaggagtttttatctttaaatggacatcttcttggacgacagccatttcct
aatattgtacagctgggcctctgtgaactggaaacttcagaagtttatcagcaagctaag
ctgaaggccaagcaggaggtcgataacggaatgctttacgtggaatggataaacaaagaa
aacatcaagaatctctcccgcttggtcgtccgcccccatacagatgctgtgtaccatgct
tgcttttctgaggatggtcaaagaatagcttcttgtggagctgataaaaacttgcaggtt
ttcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaggatgaagtgctt
tgctgtgcattctctgcagatgacagatttatagcaacctgctcagtggataaaaaagtg
aagatttggaattctacgtctggggaactagtacatacctatgacgagcactcagagcaa
gtcaattgctgccacttcaccaacaacagtaatcaccttctcttagccactggttcagat
gactgcttcctcaaactctgggctctgaatcaaaaagaatgtcgaaataccatgtttggc
catacaaattcagtcaatcactgcagattttcaccagatgataagcttttggctagttgt
tcagctgatggaacattaaagctttgggatgtgaaatcagcaaacgagaggaagagcatt
aatgtgaagcagttcttcctaaattcagaggagcctcaagaggatatggaagtgatagtg
aaatgctgttcatggtctgctgatggtgctaggataatggtggcagcaaaaaataaagtc
tttctgtttgacattcacaccagtggcctgttggcagaaatccacacaggccatcatagc
actgtccagtactgtgacttctccccccataaccatttggcagtggtggctttgccccag
tactgcgtggagttgtggaatatggactcatgtttaaaagtagctgattgtagaggacat
ttaagttgggtccattgtgtgatgttttctcctgatggatcatcatttttgacgtcttct
gatgaccagacaatcaggctctgggagacaaagaaagtatgtaagaactctgctatagcg
ttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgatggttcttgcagttgat
gatataaaacgtctgcaactccttaatggaaacacaggtcagattgagtatctgactgaa
gctcaagtgagttgctgttgcttaagtccacatcttcagtaccttgcatttggaggcgaa
gatggagccattcggattttagaaatcctaaacaacagaatcttccaatccaggactggg
cacaagaacactgtacggcacatccagttcacagctgatgcaaagactcttatctcaagc
tctgatgactctgcaattcaggtatggaattggcaatcagaggaatatgtctttctgcaa
gcccatcaggaaactgtgaaagactttagactcttgaaaaattcaagactgctttcctgg
tcgtttgatggaacagtgaaggtatggaatattattactggaagaatagaaaaagacttt
gtctgtcatcaggatacagttctttcttgtgatatttctcctgatgcaaccaagtattct
tctacctctgctgacaagactgcaaagatttggagttttgaactcctttcccctcttcat
gaattgagaggccacaaaggctgcgtgcgctgctctgccttctctgtggacagtaccctg
ttggcaactggagatgacaacggagaaatcaggatatggaatgtctcaaatggtgagctt
cttcatttgtttgctccgatttcagtagaagaaggagctgctactcacggaggctgggtg
actgacctttgcttttctccagatagcaaaatgcttgtttctgctggaggatatcttaag
tggtggaatgttgtcactggggaatcctcacagaccttctacacaaatggaaccaatctt
aaggaaatacatgtgtcccctgacttcaaaacatatgtgactgttgataatcttggtatt
ttatatattttaaagattttagagtaa

DBGET integrated database retrieval system