KEGG   Danaus plexippus (monarch butterfly): KGM_200103Help
Entry
KGM_200103        CDS       T04344                                 

Definition
(GenBank) putative Thd1
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    KGM_200103
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dpl03400]
    KGM_200103
Enzymes [BR:dpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     KGM_200103
DNA repair and recombination proteins [BR:dpl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     KGM_200103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: OWR54145
UniProt: A0A212FK72
LinkDB All DBs
Position
Unknown
AA seq 1275 aa AA seqDB search
MEPQNKRDIGNRTHLCIELTEEGEEKPKAAESQDDGYETSNSGEAARRKPSSAEGSPAPP
PPRSPPPDVEPDQEPEPEPEPEPEPEHEHEHEHEHETAYEPLLQRPFPSPYRHFEPPPAH
PQQHQPPPAHDPEPYQHFHFPKYPQDPYAFKRETDAPYDMTQHHQHPHQQLHHNQYAKRD
DEIYNGVKRECEDPYSFVEEEAMCAMLGQQHHLQHLQHHDQHHHQHMQIHPQQMMLNQPK
KRGRKKKIKDENGLELKVDGVLDSVSGIVRPVKERKKHDRFNGMSEEEVSRRTLPDHLAE
NLDIIIIAQPDHIAEDLVIMTIGINPGLFAAYKGHHYAGPGNHFWKCLYLSGLTREQMSA
DEDYKLLNFGIGFTNMVSRPTKGSADLTRREIKEGSAILLEKLQTFRPKVAVFNGKLIYE
VFSGKKDFCFGKQPDCIAGTNTYMWVMPSSSARCAQLPRAADKVPFYAALKKFRDYLNGL
LPRLDDAELVFPDTTSRRPHEEMEIRRLTMEPEPGDTIILEDGTEVPLKKKRGRPKKVKL
ENGETVPAVPRAPRQPRPPPSMETGDQPAKKKRGRPKKIRPEEQQFLLQQQQQQQQQQQQ
QQQQQQQQNNSMLQPQLSSMTQLPHEQFLHNSSGDFQQMSSPLGVGGVGVGVGNVGVGSV
GGVSNVSSGVMYGVQHQHQQQMSDSSPYYQPNNSGGMDSPLDVGGGLGMSRGYGSPGGVG
VGGVGFAASPRHAHSYASPRSQPYSPGPQRLAATPQPQQQFPSSPAAFSAPSPPRAGYGS
PGVGGVGVVGGVGGVGGSRGFAARSPLYASSPAAYRQQPSPAAQPQPRFTHDGMPFARDT
QSGSVSTSGGGFSCSPGVAGVVGVGVVGGSTPFPAASPAAHSYTPSPAHTPYSHHSSPAP
APAPHTPYDSHHFANQGSGSSGSGGGSGSGYGAELSSDIGAAISSPAPVSPACATLDFEP
PRDDSPMGSTDMHPGSNSNSSLSDYNKQSNPGGGEMSPAGVGAGSFGGALYDDTRLAYSD
KPDYHYQEQGNGVGDSPRLDQLHQHPSMYPSNFNRSTPTGDSDSGFGRGSFRAPELHHPP
PAGSPSEYSGGGESGNGTPKSKSQDVASKSLSGLESLVDQIPSIADGPAGVGGVGGVGAA
VGSVGEQGSAPPVPSLPEYTPALYPPYPAYGAPAYGNNSYGAPFVGYGGGWGTQLMRPAP
GYLPDWQYGYGPPAYASYNSPYYNGYPGPPPAHHQQTHYLSPPLLELHKSGEHAAAVSAV
PAVPSVPSVGFGGFC
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcaaaataagcgagacattggtaaccgaacgcacctgtgcattgagttgacg
gaggagggcgaggagaagccgaaggcggcggagagtcaggacgatgggtacgagacgagc
aacagcggagaggcggcgcgccggaaaccctccagcgccgagggttcacccgcgccgcct
ccgcctcgctcgccgccccccgacgtcgagcccgaccaggaacccgagcccgagcctgag
cctgagccggagcccgagcatgagcacgagcatgagcacgagcacgaaacagcatacgag
ccgctcctacagcgacccttcccatccccatacagacacttcgagccgccgccggctcat
ccccagcaacaccagcccccgccggctcacgacccggagccgtaccaacacttccacttc
cccaaataccctcaggatccgtacgctttcaaacgggagacggacgcgccatacgacatg
acgcagcatcaccaacacccgcatcaacaactacatcataaccaatacgctaagagagac
gatgagatatataacggtgtgaaacgggagtgcgaggatccgtactcgttcgtcgaggag
gaggcgatgtgcgcgatgctcgggcaacagcaccacctgcagcacctgcagcatcacgac
cagcaccaccaccagcacatgcagatccacccgcagcagatgatgctcaaccagcccaag
aaaaggggccgcaagaagaaaataaaagatgaaaacgggttggaacttaaagtggacgga
gttttagacagcgtgtcgggtatcgtgcgtccggtgaaggagcggaagaaacatgaccgg
ttcaacgggatgagtgaggaggaggtgtcgcgacgcacactgcccgaccacctcgcggag
aacctcgacatcatcattatagcacagcccgaccacatcgcagaggaccttgtcattatg
actatcggtatcaacccgggtttgttcgccgcctacaagggtcatcactacgctggtccc
gggaaccacttctggaaatgtctctacctatccggactcacgcgggaacagatgagcgct
gacgaggattacaagcttctaaactttggcatcggcttcacgaacatggtgtcccgtcct
accaaaggctcagcggatctcacgaggagggagatcaaggaaggatccgccattttgttg
gagaagcttcagaccttccgacccaaggtggccgtgttcaacgggaaattgatctacgaa
gtgttctccgggaagaaggacttctgtttcgggaaacaacccgactgtatcgccgggact
aacacttacatgtgggtgatgccgtcgtcgtcggctcgttgcgcccagttgccgcgggcc
gccgacaaggtcccgttctacgcggccttgaagaagttcagggactacctgaacggtctc
ctgccgcggctggacgacgccgagctggtcttccccgacaccacctccaggcggccgcac
gaggagatggagatacgcagactgacgatggagcccgagccgggcgacaccattatacta
gaggacggcacggaagtcccgctcaagaagaaacgcggccgacccaagaaggtgaagttg
gagaacggggagacggtgcccgcggtcccccgggcgccgcggcagccccggcctccgccc
tccatggagaccggggaccagcccgctaagaagaagagaggccgccccaagaaaataaga
cccgaggagcagcagtttctcctgcagcaacagcaacaacaacagcagcagcagcaacag
caacaacaacaacagcaacagcaaaacaattcgatgctgcagccgcagctatcgtccatg
acacagctgccgcacgagcagttcctccacaactctagcggggacttccagcagatgtcg
tcgccgttgggagtgggcggtgtgggcgtgggcgtgggcaacgtgggcgtcggcagtgtg
gggggagtgagcaacgtcagcagtggtgtcatgtacggtgtgcagcatcagcaccagcag
cagatgtccgactcgtcgccgtactaccaacctaacaatagcggcggtatggattctccg
ttagacgtgggcggaggtctgggcatgtcccgtggttacggttcacctggcggcgtgggc
gtgggcggcgtgggcttcgcggcgtcaccacggcacgcgcactcgtacgcgtcaccgcgc
tcacagccatactcacctggaccacagagactcgctgctacgccgcaaccacagcaacag
tttccatcgagcccggcggcattttcggcgccatcgccgccacgtgctgggtacggttca
cccggagtgggcggtgtgggcgtcgtgggcggtgtggggggtgtgggcggatcgcgcggg
ttcgcggctcgttccccactgtatgcgagctccccggccgcttaccgccagcagccgagc
ccagccgcccagccccagccaaggtttacacacgatgggatgcctttcgctagagacaca
cagagcggttcagtatcaacttccggcgggggtttctcgtgttcccccggcgtggcgggc
gtggtgggggtgggggtggtggggggtagtaccccgttcccggcggcgtcccccgccgct
cactcgtacaccccgtctccagcccacacgccgtactcgcaccactcgtccccagcgccg
gccccagcccctcacacgccgtatgattcacatcattttgccaatcagggaagtggatcg
agcggctcgggcggcggctcgggctcgggctacggtgcagagttgtctagcgacatcggt
gcggcgatatcgtccccggcgcccgtgtcgccagcctgcgccaccctggacttcgagccg
ccccgtgatgactcgccaatgggcagcacagacatgcatccgggcagcaacagcaactcc
tcgctgtccgactacaataagcagagtaatccgggcggaggcgagatgtcgccggccggt
gtgggcgcgggctcgttcgggggcgctctgtacgacgacacgagactagcgtacagcgac
aaacccgactatcattaccaggaacaaggcaatggtgtgggagacagccctcggttagat
caattacatcaacatccctccatgtatcctagcaattttaacaggtcaacgcctaccgga
gacagcgactcgggcttcggccgcggctcgttccgggcgcccgagttacaccaccctccg
cctgcaggttcccccagtgagtacagcggcggaggcgagtctggtaacggaactcctaaa
agcaaatcacaggacgtggcttccaagtcgctatcgggactggagtcgctcgttgaccag
ataccttccatagcggacggcccggcgggcgtgggcggtgtgggcggcgtgggcgcggcc
gtcggcagcgtgggcgaacagggcagcgccccaccagtgccctcgctgccagagtacacg
ccagcgttatacccgccatacccggcgtacggcgcaccggcatacggaaataacagctac
ggcgctccgtttgtcggttacggcggtggttggggcacccagctgatgcggccggcgccg
ggctacttaccggactggcagtacgggtacggtccgcccgcgtacgcctcatacaactca
ccgtactacaacggatatccgggaccgccgcccgcgcaccaccaacagactcactacctg
tccccgccgctgttggagctccacaaaagcggcgagcacgcggccgccgtgtctgcggtg
cccgcggtcccctccgtgccctccgtcggcttcgggggcttctgttag

DBGET integrated database retrieval system