KEGG   Danio rerio (zebrafish): 100151416
Entry
100151416         CDS       T01004                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04110  Cell cycle
dre04115  p53 signaling pathway
dre04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100151416 (cdkn1a)
   04068 FoxO signaling pathway
    100151416 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100151416 (cdkn1a)
   04115 p53 signaling pathway
    100151416 (cdkn1a)
   04218 Cellular senescence
    100151416 (cdkn1a)
SSDB
Motif
Pfam: CDI WDCP
Other DBs
NCBI-GeneID: 100151416
NCBI-ProteinID: NP_001121892
ZFIN: ZDB-GENE-070705-7
Ensembl: ENSDARG00000076554
Vega: OTTDARG00000023293
UniProt: A5WWG2
LinkDB
Position
22
AA seq 154 aa
MAAHKRILRSLGNGPTRRSLFGPVDREQLQREYRAALRRDLEDASRRWSFDFASEKPLEG
GDFHWEGVSGVRVPLLYRACQEKQQKRPCEAHQPGQSAAGKENIPKTPERCAALPHEVEK
TPEKSSELKRKQTNITDFYQAKKRLVATPRKSGQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcggcgcacaagcggatcctacgttcactcggtaatgggccgactaggcggagtctt
ttcgggccggtggaccgcgagcagctgcagcgtgagtaccgggcggcgctacggcgcgat
ctggaggacgcatcgcgacgctggagcttcgactttgcgtctgagaaaccactagagggc
ggagacttccactgggagggcgtgtccggcgtgcgcgtgccactactgtaccgcgcgtgt
caggaaaagcagcagaaacggccctgtgaggctcatcagcccggacagtccgccgctgga
aaggaaaacatcccgaaaacaccagaacgatgtgctgcactcccgcatgaagtggagaaa
accccagagaagagcagcgagctgaagcgcaaacagaccaacatcacagatttctaccaa
gccaagaagcgtctagtggccacgccgcgcaaatccggccagtag

DBGET integrated database retrieval system