KEGG   Danio rerio (zebrafish): 553668Help
Entry
553668            CDS       T01004                                 

Gene name
galnt7
Definition
(RefSeq) N-acetylgalactosaminyltransferase 7
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    553668 (galnt7)
   00514 Other types of O-glycan biosynthesis
    553668 (galnt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    553668 (galnt7)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     553668 (galnt7)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   553668 (galnt7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 553668
NCBI-ProteinID: NP_001018477
ZFIN: ZDB-GENE-050522-284
Ensembl: ENSDARG00000057303
Vega: OTTDARG00000029912
UniProt: Q502M4
LinkDB All DBs
Position
1
AA seq 652 aa AA seqDB search
MRLKVGFILRSLLVISTFLGLVLLWSSLTPKAGDDNPFAGVMAREADKLPQPNLPNNNVA
DQFKPVVPWPHVEGVEVDLESIRQKNVDNPNPAFKAQNQQNVIQKQYITFKPHTNMYSDP
VLNKGTLGNFEPKEPEPHGVQGGPGEGSKPFVLGPEYKDAVQASIKEFGFNMVASDMISL
DRTVGDLRHEECKYWNYDENLLTSSVIIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVMI
DDFSNKAHLKERLEEYIKQWNGLVKVFRNEKREGLIQARSIGARKATLGKVLIYLDAHCE
VGVNWYAPLVAPISKDRTVCTVPLIDYIDGNDYTIEPQQGGDEDGLARGAWDWSLLWKRV
PLSSREKAKRKHKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEISYKIWQ
CGGQLLFVPCSRVGHIYRLQGWQGNPPPAHVGSSPTLKNYVRVVEVWWDDYKDYFYASRP
ETLTLAYGDISTLKKFREEHRCKSFKWFMEEIAYDIPLHYPLPPKNVEWGEIRGYETSYC
IDSMGHTNGGNVEIGPCHRMGGNQLFRINEANQLMQYDQCLTKGGDGSAVIITHCNLNEH
TEWKYFKDLHRFTHVPTGKCLDRSDVLHKVYIADCDNSKSSQKWEMNNIVAV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaaaggttggattcatccttcgaagtttgctggtcatcagcacatttttgggg
ctggttttgctttggtcttctttgacaccgaaggctggagacgataacccgtttgctggt
gtaatggcaagagaggctgataaactcccgcagcccaaccttcccaataacaacgttgca
gaccagtttaagccagttgttccttggccccatgtcgaaggagttgaggtcgatctagag
tccatccgccagaagaatgtggacaacccaaacccagcattcaaagcccaaaaccagcag
aatgtcatccagaagcaatatatcacttttaaaccccacaccaatatgtacagtgatcct
gttttgaacaaagggactctgggcaactttgagccgaaagaacctgagcctcatggggtc
cagggcggaccgggagagggcagtaaaccgttcgttctgggaccagagtacaaagatgcg
gttcaagccagcatcaaggaatttggctttaatatggtagccagtgacatgatctctctg
gatcgaactgttggtgacttgcgtcatgaagagtgtaaatactggaactatgatgaaaac
ctcctcacctccagtgtgatcatagtctttcataatgagggctggtccaccctgatgagg
acggtgcacagtgtcatcaaaagaaccccaaggaaatacctggctgagatcgtcatgatt
gatgacttcagtaacaaagctcaccttaaagagcggctggaggagtacataaaacaatgg
aacgggttggtcaaagtgttccgcaatgagaagagagagggtctgatccaggccaggagc
ataggagcccgcaaagccactttaggaaaggtgctgatctacctggatgcacattgtgag
gtcggagtgaactggtatgccccgctggtggcccccatttcaaaagacagaacggtctgc
acagtaccgttgatagattacatagacggcaatgattataccatagagccacaacagggt
ggggatgaggacggtctggcgcgaggcgcttgggactggagcctcctgtggaaaagggtt
cctctaagcagcagggagaaggctaagagaaagcataagaccgagccctatcggtctcct
gccatggctggagggctgtttgcaattgagagagaattcttctttgagttgggtctttat
gatccaggccttcagatctggggaggtgaaaactttgagatctcatacaagatatggcag
tgcggtgggcagcttctgttcgtgccatgttcacgggtggggcacatctaccgtctgcag
ggctggcagggaaacccacctcctgctcatgtcggctcatccccaacacttaagaactat
gtgcgggtggtggaggtatggtgggatgattacaaggactatttctacgctagtcgaccg
gagacactcactctggcctacggggacatcagcaccttgaaaaagttcagagaggagcat
cggtgcaagagcttcaagtggttcatggaggagattgcctatgacatccctctgcattac
ccattgcctccaaaaaatgttgaatggggagagattcgtggatacgagaccagctactgc
attgacagcatgggccacactaatggtggcaatgtggagattgggccttgtcatagaatg
ggtggcaatcagctcttcagaattaatgaagctaaccagctgatgcagtacgaccagtgc
ctgacaaaggggggagatggatctgctgtcatcataacacactgtaacttgaacgagcac
acagagtggaaatattttaaggatctacaccgattcacacatgtacctacaggaaaatgc
ttggatcgctctgacgtcctgcacaaggtctatatagcagactgtgacaacagtaagagc
tcgcagaagtgggagatgaacaacatcgtggcagtataa

DBGET integrated database retrieval system