KEGG   Danio rerio (zebrafish): 556995Help
Entry
556995            CDS       T01004                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03030  DNA replication
dre03410  Base excision repair
dre03420  Nucleotide excision repair
dre03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    556995 (lig1)
   03410 Base excision repair
    556995 (lig1)
   03420 Nucleotide excision repair
    556995 (lig1)
   03430 Mismatch repair
    556995 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dre03032]
    556995 (lig1)
   03400 DNA repair and recombination proteins [BR:dre03400]
    556995 (lig1)
Enzymes [BR:dre01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     556995 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     556995 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     556995 (lig1)
DNA replication proteins [BR:dre03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    556995 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     556995 (lig1)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     556995 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     556995 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     556995 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 556995
NCBI-ProteinID: NP_001119860
ZFIN: ZDB-GENE-110404-2
Ensembl: ENSDARG00000060041
Vega: OTTDARG00000035278
UniProt: B0S533
LinkDB All DBs
Position
2
AA seq 1058 aa AA seqDB search
MQRSIASFFQPMKGKEKSDGQAKGKPGPVKSPLKIQNGVQESDSPIKKVHKRSRAILDSD
EEDGDQPMVKEQEPKQSEVQTVKKEKISDVKTAEVTKASSTPVSPKSPKTPTTPVTSSTS
VSVVTPASSGTPGTPATPTSVSPSGIPKRKTARKQFPKRKLESRSDGEELKEEEKEVDGG
QESKRARVDSSPEQTENEMMEVDETSADEKTAVEEKEDKAKTSVVVDSEMKDEDDKKQKI
NTNNEAKEKDKNESKQEEKIDTEKETKEKDKKINKQQEKKETKKETKEKDKSDKKQEEKD
KSDKKQEEKDKTEEKVNGENEKEKIPDKKGKESSSPEKVVKKEKDTDGGSAKKKPISSFF
APRKAAVKLEKEERNEGEKKKDGETSDVVEQKEKKSEKGVDSAVQSQYDPSRAHYHPIDH
ACWKKGQKVPYLAVARTFEKIEEDSGRLKNIETLSNFLRSVILLSPDDLLCCVYLCLNQL
GPAYQGLELGIGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPAN
LTAGGVFNKLKEIAHMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQS
VLAALSQAVCLTPPGQEFPPAVLDAGKGMSTENRRVFLEEKALILKQTYCEMPNYDAIIP
VLLKEGIDELPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHI
LENGEVRIFSRNQEDNTSKYPDIISRIPQVKKESVRSCVLDSEAVAWDREKKQIQPFQVL
TTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVREPLSKRRALLRESFVEKEGEFVFARS
LDADNTETIAEFLEQSVRDSCEGLMVKTLEKHATYEIAKRSHNWLKLKKDYLEGVGDTVD
LCVIGAYLGKGKRAGGYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYNFLKEHILP
KPRPYYRVDQSAEPDVWLEAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRFLRI
RDDKKPEDATTGSQIADLYKKQQQIQNQGDKPDLEDYY
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcgtctttctttcagccaatgaaaggcaaggagaagagtgatgga
caggccaagggaaagccaggaccagtaaaaagtcctcttaaaattcagaatggcgtgcag
gaaagtgattcgccaataaagaaggttcataaacgcagtcgagcaatcctagacagcgat
gaagaagatggagatcagccaatggtcaaggagcaggagccaaaacagagtgaagttcaa
acagtaaagaaagagaagatttctgatgttaagacggctgaggtaacaaaggcttcctct
actcctgtatctccaaaatcccccaaaaccccaacgactccggtcacttcgagcacctct
gtttctgttgtaactcctgcgtcctctgggactcctggaactccagcaactccaacatca
gtgtcaccgtcaggcattcccaaacgcaagactgctcgtaagcagttccctaagaggaag
ctggaaagcaggagtgatggagaagaactaaaagaggaagagaaggaggtcgatggagga
caggagagtaagagagcacgagtcgactcttcaccagaacagacagagaatgagatgatg
gaggtggacgagacgagtgctgatgaaaagactgcagttgaggagaaagaggacaaggcg
aaaactagtgtagttgtggacagcgagatgaaagatgaagatgacaagaagcagaagata
aatacaaacaacgaggcaaaagagaaggataaaaatgagagtaagcaagaggagaagata
gatacagaaaaggagacgaaagaaaaggataaaaagatcaataagcagcaggaaaagaaa
gaaacaaaaaaggagacaaaagaaaaggataaaagtgacaaaaagcaggaggaaaaagat
aaaagtgacaaaaagcaggaggaaaaggataaaactgaggaaaaagtaaatggtgagaat
gaaaaggagaaaataccggacaagaaaggaaaagaaagcagcagtcctgaaaaagtggtg
aaaaaagagaaggacacagacggaggatctgccaaaaagaaacccatcagcagctttttt
gcacccagaaaggctgcagttaaactggaaaaagaagagcgaaatgaaggagagaaaaag
aaagatggagagacctctgatgtggtggaacagaaagagaagaaaagtgaaaagggagtg
gattctgcagtccagagccaatatgatccttctagagcacattatcatcccattgaccac
gcctgctggaagaagggtcaaaaagtgccatatttggctgttgctcgcacctttgagaaa
attgaagaggattctggaaggctaaaaaatattgaaactctttccaactttctgcgctct
gtaattctgctatctccagatgacctgctgtgttgtgtgtacctgtgtctgaatcagctg
ggccctgcgtatcagggtctggagttgggcatcggggagacggtacttatgaaagccgtc
gctcaagcaaccgggcgacaactagacaaaatcaaggcggaggctcaggagaaaggagac
ctgggattggttgctgaaagttcccgcagtaaccagagaatgatgtttgcaccggctaat
ctgacagcagggggtgttttcaacaaactgaaggagattgctcacatgagtggaaactcg
gcaatgaataagaagattgacattattaaaggcctttttgtggcgtgtcggttttctgag
gcccgatacattgtgcggtcgttggcggggaagttgcggatcggattggctgagcagagt
gttcttgcagctctcagtcaggctgtgtgtctgacgcctccaggccaagagttcccacca
gctgtgttggatgcaggaaaaggaatgagtacagaaaacaggagagtattcctagaggag
aaagcactaatcctgaaacagacatattgtgagatgccaaattatgatgcaatcattcct
gtattgctgaaggaggggattgatgaactgcccaatcactgcaagctcactccaggggtt
cctctgcgacccatgttggctcatccgactaaaggggttggtgaggtaatgaaacgtttc
gatgaagcctccttcacctgcgagtacaaatatgatggagagagagcccagatccatatt
cttgagaacggagaggtgcgcattttcagcagaaaccaagaggacaacacgagcaaatac
cctgatattatctcacgaatcccacaggtgaagaaagagagcgtacggtcctgtgttctg
gattcagaggcagtggcttgggacagagaaaagaaacaaatccagccgtttcaggtcctc
accacaagaaagaggaaggatgtggatgcatctgagatcaaggttcaggtgtgtgtgtac
gccttcgacctgctgtacctcaatggagagtctctggtgcgagagcctctaagcaaacgc
agggctttgttacgagagagttttgtggagaaagaaggagagtttgtttttgctcgatct
ctggatgctgacaatacagaaaccatcgctgagttcctggagcagtctgtacgagattct
tgtgaaggcctaatggtgaaaacattggaaaagcatgcaacttatgagattgccaaacgc
tcccacaattggctcaagctgaaaaaggactatctggagggtgttggagacaccgtggat
ctgtgtgtgattggtgcatatctgggcaaggggaagagagcaggcggctatggaggattt
ctgctggcctgctatgatgaagagaacgaggaattccagtctgtttgcaagattggaaca
ggattcaaagacgaagatctggagcagcattacaacttcttaaaggagcacattttaccc
aaaccccgcccgtactaccgtgtagaccaatcagcagagccggatgtatggctggaggcg
gtgcaggtgtgggaggtgaaatgcgctgacctttccctgtctccagtctacaaagcagcc
atgggattggtggacccagagaaaggcatttccctccgtttcccacgattcctcaggatc
agagatgacaaaaagccagaggatgccaccacagggtcgcagattgctgatctctacaag
aaacagcagcagattcaaaatcagggtgacaaaccagatttggaggactactattga

DBGET integrated database retrieval system