KEGG   Equus asinus (ass): 106828814
Entry
106828814         CDS       T04645                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
eai  Equus asinus (ass)
Pathway
eai01523  Antifolate resistance
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04062  Chemokine signaling pathway
eai04064  NF-kappa B signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04210  Apoptosis
eai04380  Osteoclast differentiation
eai04620  Toll-like receptor signaling pathway
eai04621  NOD-like receptor signaling pathway
eai04622  RIG-I-like receptor signaling pathway
eai04623  Cytosolic DNA-sensing pathway
eai04625  C-type lectin receptor signaling pathway
eai04657  IL-17 signaling pathway
eai04658  Th1 and Th2 cell differentiation
eai04659  Th17 cell differentiation
eai04660  T cell receptor signaling pathway
eai04662  B cell receptor signaling pathway
eai04668  TNF signaling pathway
eai04920  Adipocytokine signaling pathway
eai05132  Salmonella infection
eai05135  Yersinia infection
eai05142  Chagas disease
eai05145  Toxoplasmosis
eai05160  Hepatitis C
eai05161  Hepatitis B
eai05162  Measles
eai05163  Human cytomegalovirus infection
eai05164  Influenza A
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05168  Herpes simplex virus 1 infection
eai05169  Epstein-Barr virus infection
eai05170  Human immunodeficiency virus 1 infection
eai05200  Pathways in cancer
eai05203  Viral carcinogenesis
eai05212  Pancreatic cancer
eai05215  Prostate cancer
eai05220  Chronic myeloid leukemia
eai05221  Acute myeloid leukemia
eai05222  Small cell lung cancer
eai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eai05340  Primary immunodeficiency
eai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106828814 (IKBKG)
   04014 Ras signaling pathway
    106828814 (IKBKG)
   04064 NF-kappa B signaling pathway
    106828814 (IKBKG)
   04668 TNF signaling pathway
    106828814 (IKBKG)
   04151 PI3K-Akt signaling pathway
    106828814 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106828814 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106828814 (IKBKG)
   04621 NOD-like receptor signaling pathway
    106828814 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    106828814 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    106828814 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    106828814 (IKBKG)
   04660 T cell receptor signaling pathway
    106828814 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    106828814 (IKBKG)
   04659 Th17 cell differentiation
    106828814 (IKBKG)
   04657 IL-17 signaling pathway
    106828814 (IKBKG)
   04662 B cell receptor signaling pathway
    106828814 (IKBKG)
   04062 Chemokine signaling pathway
    106828814 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106828814 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106828814 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106828814 (IKBKG)
   05203 Viral carcinogenesis
    106828814 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106828814 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106828814 (IKBKG)
   05221 Acute myeloid leukemia
    106828814 (IKBKG)
   05220 Chronic myeloid leukemia
    106828814 (IKBKG)
   05215 Prostate cancer
    106828814 (IKBKG)
   05222 Small cell lung cancer
    106828814 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    106828814 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106828814 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106828814 (IKBKG)
   05135 Yersinia infection
    106828814 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106828814 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    106828814 (IKBKG)
   05162 Measles
    106828814 (IKBKG)
   05164 Influenza A
    106828814 (IKBKG)
   05161 Hepatitis B
    106828814 (IKBKG)
   05160 Hepatitis C
    106828814 (IKBKG)
   05168 Herpes simplex virus 1 infection
    106828814 (IKBKG)
   05163 Human cytomegalovirus infection
    106828814 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106828814 (IKBKG)
   05169 Epstein-Barr virus infection
    106828814 (IKBKG)
   05165 Human papillomavirus infection
    106828814 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106828814 (IKBKG)
   05142 Chagas disease
    106828814 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    106828814 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106828814 (IKBKG)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   106828814 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Filament
Other DBs
NCBI-GeneID: 106828814
NCBI-ProteinID: XP_014693063
LinkDB
Position
Un
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQDVLGDESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQHFQSSQREEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALKEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHNVQVDQLRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEAIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKECLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPLPPTPAHHSIHSALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtacagcctagtggcggcccg
gcaggggaccaggacgtgctgggtgacgagtcttctctggggaagccggccatgctccac
ctgccttcggagcagggaactcctgagaccttccagcgttgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
catttccagagcagccagagggaggagaaggagttcctcatgcagaaattccaggaggcc
agaaaactggtggagagactgagcctggagaagcttgacctgaggaggcagcgggaacag
gctctgaaggaggtggaacacctgaagagatgccagcagcagatggccgaggataaggcc
tcagtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg
gaggccgccactaaggagcggcaggctctggagggcagggcccgggcggccagtgagcag
gcccggcagctggagagtgagcgggaggcgctgcagcagcagcacaacgtgcaggtggac
cagctgcgcatgcagacccagagcatggaggctgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagag
tatgacaaccacatcaagagcagcatggtgagcagtgagcggaaccgaggaatgcagctg
gaagatcttaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagcg
attgacaagctcaaggaagaggccgagcagcataagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggcggaaaggcaggcccgggag
aagctggctgagaaaaaggagtgtctgcaggagcagctggagcagctgcagagggagtac
agccggttgaaggccagctgtcaggagtcagccaggatcgaagatatgaggaagcggcat
gtagaggtctcccagccccctttaccccccaccccagctcaccactccattcactcggcc
ctgcccagccagaggagaagtccccccgaggagccacccgacttctgttgccccaagtgc
cagtaccaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system