KEGG   Equus caballus (horse): 100051866
Entry
100051866         CDS       T01058                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04714  Thermogenesis
ecb04722  Neurotrophin signaling pathway
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04935  Growth hormone synthesis, secretion and action
ecb05034  Alcoholism
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100051866 (GRB2)
   04012 ErbB signaling pathway
    100051866 (GRB2)
   04014 Ras signaling pathway
    100051866 (GRB2)
   04630 JAK-STAT signaling pathway
    100051866 (GRB2)
   04068 FoxO signaling pathway
    100051866 (GRB2)
   04072 Phospholipase D signaling pathway
    100051866 (GRB2)
   04151 PI3K-Akt signaling pathway
    100051866 (GRB2)
   04150 mTOR signaling pathway
    100051866 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100051866 (GRB2)
   04540 Gap junction
    100051866 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100051866 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100051866 (GRB2)
   04660 T cell receptor signaling pathway
    100051866 (GRB2)
   04662 B cell receptor signaling pathway
    100051866 (GRB2)
   04664 Fc epsilon RI signaling pathway
    100051866 (GRB2)
   04062 Chemokine signaling pathway
    100051866 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100051866 (GRB2)
   04912 GnRH signaling pathway
    100051866 (GRB2)
   04915 Estrogen signaling pathway
    100051866 (GRB2)
   04917 Prolactin signaling pathway
    100051866 (GRB2)
   04926 Relaxin signaling pathway
    100051866 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    100051866 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100051866 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100051866 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100051866 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051866 (GRB2)
   05206 MicroRNAs in cancer
    100051866 (GRB2)
   05205 Proteoglycans in cancer
    100051866 (GRB2)
   05203 Viral carcinogenesis
    100051866 (GRB2)
   05231 Choline metabolism in cancer
    100051866 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051866 (GRB2)
   05225 Hepatocellular carcinoma
    100051866 (GRB2)
   05226 Gastric cancer
    100051866 (GRB2)
   05214 Glioma
    100051866 (GRB2)
   05221 Acute myeloid leukemia
    100051866 (GRB2)
   05220 Chronic myeloid leukemia
    100051866 (GRB2)
   05211 Renal cell carcinoma
    100051866 (GRB2)
   05215 Prostate cancer
    100051866 (GRB2)
   05213 Endometrial cancer
    100051866 (GRB2)
   05224 Breast cancer
    100051866 (GRB2)
   05223 Non-small cell lung cancer
    100051866 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    100051866 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100051866 (GRB2)
   05160 Hepatitis C
    100051866 (GRB2)
   05163 Human cytomegalovirus infection
    100051866 (GRB2)
   05165 Human papillomavirus infection
    100051866 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100051866 (GRB2)
   01522 Endocrine resistance
    100051866 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100051866 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100051866 (GRB2)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100051866 (GRB2)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100051866 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH2_2 SH3_3 DUF5093 hSH3 SH3_4
Other DBs
NCBI-GeneID: 100051866
NCBI-ProteinID: NP_001270013
Ensembl: ENSECAG00000010007
VGNC: 18570
UniProt: L7MSX1
LinkDB
Position
11
AA seq 203 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQEDGELGFRRGDFIHVMDNSDPNWW
KGACHGQTGMFPRNYVTPVNRNV
NT seq 612 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatatgacttcaaagctactgcagacgacgagctgagcttcaaa
aggggggacatcctcaaggttttgaatgaagaatgtgatcagaactggtacaaggcagaa
ctcaatgggaaagatggcttcattcccaagaattacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagccaaggcagaagaaatgcttagcaaacagcggcatgat
ggggcctttcttatccgagagagtgagagtgctcctggggatttctccctctctgtcaag
tttggaaacgacgtgcagcacttcaaggtgctccgagatggagctgggaagtatttcctt
tgggtggtgaagttcaattctttgaatgagctggtagattatcacagatccacatctgtc
tccagaaaccagcagatatttctccgggacatagaacaggtgccacaggaggatggagag
ctgggattccgtcggggagactttatccacgtcatggataactcagaccccaactggtgg
aaaggggcttgccacgggcagaccggcatgtttccccgcaattatgtcacccctgtgaac
cggaacgtctaa

DBGET integrated database retrieval system