KEGG   Electrophorus electricus (electric eel): 113587986
Entry
113587986         CDS       T05787                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04210  Apoptosis
eee04620  Toll-like receptor signaling pathway
eee04621  NOD-like receptor signaling pathway
eee04622  RIG-I-like receptor signaling pathway
eee04623  Cytosolic DNA-sensing pathway
eee04625  C-type lectin receptor signaling pathway
eee04920  Adipocytokine signaling pathway
eee05132  Salmonella infection
eee05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113587986 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113587986 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113587986 (ikbkg)
   04621 NOD-like receptor signaling pathway
    113587986 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    113587986 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    113587986 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    113587986 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113587986 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113587986 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113587986 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eee01001]
    113587986 (ikbkg)
Protein kinases [BR:eee01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113587986 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 113587986
NCBI-ProteinID: XP_026882773
LinkDB
Position
Unknown
AA seq 577 aa
MVQPQPHGDSALQWEMTGEEAIGTSSQGSLVASSQASLRVPPELAGNEVVHRLLADNNQL
REALKRSNDALKDRCEEMEGWQRRSREEREFLACKFREARALVERLAQENQSLLGKLKHS
QTAAQIDGTAETGSQVQNQVGSNTEINGLTNSPEALDEPTGKGITERDTDTRAIPRSLPI
EGSNEFLRLLKSHKDKLEEGMRDLRRRNNDLEREKTEIEKEREELRLRLSQLSQSAVIME
ETVQKNAFTVPIESSHLAKLTEQLQATQGRYKELQEKLNILQQNSIQRDRNEALLKQKEK
DYVQLTKDIEALRAQVTSLVGELHERQTCLNKCEEEKNCLEEKLCSKTEDLQILEREMEQ
QKKQHCVTVDKFLLQTQNLEAALKNERLVIVEEKRKLAQLQHAYTCLFQDYDNKLKNEQA
NSRGGETETLINRLDEAEKALALKQAHIDKLKEEVEQQRALQETIQVLTAQAEIYKLDFQ
AEREAREKLHQKKEDLQEKLSQALAEINLLKQEKMQQRHTDNYRGVVLPAPAPFQGPVIS
QPNRLLPEVQPDYRCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggttcagccccagccccacggggacagtgccttgcagtgggagatgactggagaggag
gctataggcactagcagtcaaggttcacttgtggctagttcacaagcatcactaagggta
ccacctgaactagctggaaacgaggtggtccacagacttttggcagacaacaaccaatta
cgagaggcactaaagcgcagtaatgatgccctcaaagaccgctgcgaagagatggagggt
tggcagcggagatcgagggaggagagagagtttcttgcttgtaaatttcgtgaggctcgg
gctttggtggagcgactggctcaggagaaccagagtctgttgggcaagctcaagcacagc
caaacagcagctcaaattgatggcaccgcagagaccggaagccaagttcagaaccaagtg
ggttccaatacagagattaatggactgaccaattctcctgaagctttagatgagcctaca
gggaaaggcatcacagagcgagacactgacacacgggcaattcctcgaagtttgcctatc
gaaggttctaatgaattcttgaggctgctgaagagtcacaaagacaaactggaggaggga
atgagggacctgaggagaagaaataatgacctggagagagagaagacggagatcgagaag
gaaagggaggagctccgccttcgattgtcgcagctctctcagagtgctgtgataatggag
gagacggttcagaaaaatgcttttacggtccccatagaaagctcacacctggctaaacta
acagagcagcttcaagctacacaaggcaggtataaagagctccaggaaaaactgaacatt
ctccagcagaactcaattcaaagggacaggaatgaggctctgctcaagcaaaaggagaag
gactatgttcagctgactaaggacatcgaggccctgagggcacaggtcacgtctctggtt
ggtgagctacacgagcggcagacctgcctcaacaagtgtgaagaggagaaaaactgcctg
gaggaaaagctgtgcagtaagacggaggacctgcagattctggaacgggagatggagcag
cagaagaagcagcactgcgtgaccgtggacaagttcttgctgcagacgcagaacctggag
gctgcgctcaagaacgagcgtctcgtcattgtggaggagaagaggaagctcgcccagcta
cagcatgcatacacctgtctgtttcaggactacgacaacaagctgaaaaacgagcaagcc
aattcaaggggtggcgaaacggagactcttattaacaggctggacgaagccgagaaagcc
ctggcattgaaacaggcccacattgacaaactcaaggaggaagtggagcagcagagggcc
ctgcaggagaccattcaagtgctcacggcacaggcggaaatctacaagttagacttccag
gcagagagggaggccagagagaagctccaccagaagaaggaggatctgcaggaaaagttg
agccaggcgctggctgaaatcaacctgctcaagcaggagaagatgcagcagagacacacg
gacaactacagaggggttgttctgcctgctccagcaccgttccaggggccggtgatttca
cagccaaaccggcttcttcccgaggtgcagccagactaccgatgccctaaatgtcagtac
caagcgccagacatggacaccctgcagattcatgtgatggactgtattcagtga

DBGET integrated database retrieval system