KEGG   Ehrlichia sp. HF: EHF_0257Help
Entry
EHF_0257          CDS       T03078                                 

Gene name
ligA
Definition
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03030  DNA replication
ehh03410  Base excision repair
ehh03420  Nucleotide excision repair
ehh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHF_0257 (ligA)
   03410 Base excision repair
    EHF_0257 (ligA)
   03420 Nucleotide excision repair
    EHF_0257 (ligA)
   03430 Mismatch repair
    EHF_0257 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ehh03032]
    EHF_0257 (ligA)
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0257 (ligA)
Enzymes [BR:ehh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     EHF_0257 (ligA)
DNA replication proteins [BR:ehh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     EHF_0257 (ligA)
DNA repair and recombination proteins [BR:ehh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     EHF_0257 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHF_0257 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     EHF_0257 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHF_0257 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB BRCT HHH_2 PTCB-BRCT DNA_ligase_ZBD zf-ACC
Motif
Other DBs
NCBI-ProteinID: AHX04829
UniProt: X5H1W1
LinkDB All DBs
Position
complement(273860..275890)
Genome map
AA seq 676 aa AA seqDB search
MVKQEEAKLELEKLNKQIQRHDILYHVQDNPEISDAEYDELCRKRNLILKAFPRLVSSNG
YQDNVGSSPDIRFAKVKHEEKMLSLDNAFNQQDVEKFITRTKKLLNMNDDQSISMSCELK
IDGLSFSVIYRKGEISQASTRGDGYFGENITNNVKIIKNLPHIIHNAPDLLEVRGEIYIN
RSDFIQLNNDGNNFANPRNAAAGSVRQLDYNITAQRKLKYFMYTIVNTTCVTQEELLDQL
KTWGFCVNEHTITTSNIEKAFNFYNQVYNNRSNINYDIDGIIYKINDIKSQHILGNTSKS
PRWAIAYKFPAAEAKTQLKKISIQIGRTGVLTPIAELSPINIGGVVVTRASLHNKNEIER
KDIREGDYVIVKRAGDVIPQVVDVDKNLRTQELTKFAFPTTCPSCGSSLYQAKQEASIYC
TGELFCKDQVLEKIKHFVSKDAFNIIGFGKKQLLFFYEQGFITSIVDIFRLEEKISNSDF
KLESLHGWGERSISNLFSAINNSKVISLENFIFALGIRFVGKYIAKILAKYFSSYEKWYN
EMLKLAQDENYLLNIQQIGSKTISSLKMFFTEQHNLNMINDLVKYLTITDTNSTSYLSLI
HGKTIVFTGELSSMSRSEAKVRSEAAGAKVSSSLSKNTDFLIIGNNPGSKYKKAQSLNIQ
ILTEDLWLQYTEQNES
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagcaagaagaagctaagctagagttagagaaattaaataaacaaatacagcgt
catgatattctttatcatgtacaagataatccagaaataagtgatgctgagtatgatgag
ttatgtcgtaaaagaaatctaatccttaaagcttttccaagacttgtatcaagtaacggt
taccaagataatgtaggtagttctccggatataaggtttgccaaagttaaacatgaagag
aagatgctctccttagataatgcctttaatcagcaagatgtagagaaatttataacaaga
actaaaaagctcttaaatatgaatgatgatcaatcaatatccatgtcttgtgaattaaaa
atcgatggactatcattctccgttatatatagaaaaggagaaatttctcaagcatctacg
agaggcgatggatattttggcgagaatattacgaacaatgttaaaattataaaaaatcta
ccacacattattcacaacgcaccagatctcctagaagtaagaggggaaatatacataaat
cgcagtgattttatacaacttaataatgatggaaataactttgcaaatccacgtaatgct
gcagctgggtccgtaagacaattagactataatattactgctcaacgcaaattaaaatat
tttatgtacacaatagtcaacactacatgtgtaacacaagaagaactactagaccaatta
aaaacttggggtttttgtgtaaatgaacatactattactacaagcaatattgaaaaagct
tttaacttttacaatcaagtttataacaatagaagcaacatcaattatgatattgatggt
ataatatacaaaatcaatgatataaaatcacaacatattctcggaaacacaagtaaatca
ccaagatgggctatagcttataaattccctgctgcagaagcaaaaactcaactaaaaaaa
atttctatacaaattgggagaactggtgtactaacacccattgcagaactttctcccata
aatattggtggggttgtagttacaagagcaagtttacataataaaaatgaaatagagcgt
aaagatatacgtgaaggtgactacgtcattgtcaaaagagcaggagatgtaatacctcaa
gtagttgatgtagacaaaaacctaagaactcaagaattaacaaaatttgcttttccaaca
acatgtccatcatgtggtagcagtttataccaggcaaaacaagaagcatcaatatattgt
accggagaattattttgtaaagaccaagtcttagaaaaaataaagcattttgtttcaaaa
gatgctttcaacattataggatttgggaaaaaacaattattatttttttatgagcaagga
ttcataacaagcattgttgatatatttagattagaagaaaaaataagtaatagcgatttt
aaattagagtcattacatggatggggtgagagatccataagtaatttattctctgcaata
aacaacagcaaagtaattagtttagaaaactttattttcgcattaggaatcaggtttgta
ggaaaatatatagcaaaaatactcgccaaatatttctcatcatatgaaaaatggtataat
gaaatgcttaaactcgcgcaggatgaaaattatttactcaatatacaacaaataggatcc
aaaactataagttcgctaaaaatgttttttactgaacaacataacttaaatatgattaat
gatttggtaaaatacctaacaataacagatacaaattctacttcttatttatcacttatc
catggaaaaaccatagtttttactggcgaactatcaagcatgtcaagatctgaagcaaaa
gtaaggtcagaagctgcaggagcaaaagtgtcttcatcattatcaaaaaatacagatttc
ttgattataggtaacaacccagggtcaaaatataaaaaagcacaatccctcaatatacag
atcttaactgaagatttatggctacaatacactgaacagaatgagagttaa

DBGET integrated database retrieval system