KEGG   Ehrlichia sp. HF: EHF_0750Help
Entry
EHF_0750          CDS       T03078                                 

Gene name
nth
Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHF_0750 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ehh03400]
    EHF_0750 (nth)
Enzymes [BR:ehh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     EHF_0750 (nth)
DNA repair and recombination proteins [BR:ehh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHF_0750 (nth)
 Prokaryotic type
     EHF_0750 (nth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD EndIII_4Fe-2S HHH
Motif
Other DBs
NCBI-ProteinID: AHX04360
UniProt: X5H2P0
LinkDB All DBs
Position
complement(857026..857658)
Genome map
AA seq 210 aa AA seqDB search
MDQEKINLLFTKFKEYNPYPKIELRYTNDFTLLVAIVLSARTTDVSVNKITNKLFEIADS
PGKMLNLGEKGLKSYINTIGLYNSKSRNIIALSEIIINQYNSNVPLDFDTLIALPGVGRK
SANVFLNTWLNLPTVAVDTHVFRVSNRMGLVKEDSVLKTESALLSIIPKKWLLYAHHWLV
LHGRYICKSRKPLCSQCIVQDLCEYKNKSL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggagaaaataaatttactatttactaagtttaaagagtataatccttacccg
aagatagaactgagatatactaacgattttactttgttagtagcaatagtattatctgcg
cgtactactgatgttagtgtaaataaaattacaaataaactatttgaaattgctgatagt
ccaggaaaaatgttaaaccttggggaaaaaggtctaaaaagttatataaatacaatagga
ttatataattctaaatctagaaatattattgcacttagtgaaattattataaatcaatat
aatagtaacgtacctttagattttgatactcttattgcattaccaggtgtgggaagaaag
agtgcaaatgtttttttaaacacatggttaaatttaccaactgttgctgttgacactcat
gtatttagagtaagtaataggatggggttagttaaggaagatagtgtgttaaaaacagag
agtgcattgttaagtataataccaaaaaaatggttattatatgcacatcactggttagtg
ttgcatggtagatatatatgtaagtcaaggaagccattatgtagtcaatgtattgttcag
gatttatgtgagtataaaaataagagtttgtga

DBGET integrated database retrieval system