KEGG   Enhydra lutris kenyoni (northern sea otter): 111139613
Entry
111139613         CDS       T05871                                 

Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04150  mTOR signaling pathway
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04650  Natural killer cell mediated cytotoxicity
elk04666  Fc gamma R-mediated phagocytosis
elk04670  Leukocyte transendothelial migration
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111139613
   04012 ErbB signaling pathway
    111139613
   04014 Ras signaling pathway
    111139613
   04015 Rap1 signaling pathway
    111139613
   04310 Wnt signaling pathway
    111139613
   04370 VEGF signaling pathway
    111139613
   04066 HIF-1 signaling pathway
    111139613
   04020 Calcium signaling pathway
    111139613
   04070 Phosphatidylinositol signaling system
    111139613
   04071 Sphingolipid signaling pathway
    111139613
   04150 mTOR signaling pathway
    111139613
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111139613
   04540 Gap junction
    111139613
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111139613
   04666 Fc gamma R-mediated phagocytosis
    111139613
   04670 Leukocyte transendothelial migration
    111139613
  09152 Endocrine system
   04911 Insulin secretion
    111139613
   04929 GnRH secretion
    111139613
   04921 Oxytocin signaling pathway
    111139613
   04935 Growth hormone synthesis, secretion and action
    111139613
   04918 Thyroid hormone synthesis
    111139613
   04919 Thyroid hormone signaling pathway
    111139613
   04928 Parathyroid hormone synthesis, secretion and action
    111139613
   04916 Melanogenesis
    111139613
   04925 Aldosterone synthesis and secretion
    111139613
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111139613
  09154 Digestive system
   04970 Salivary secretion
    111139613
   04971 Gastric acid secretion
    111139613
   04972 Pancreatic secretion
    111139613
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111139613
   04961 Endocrine and other factor-regulated calcium reabsorption
    111139613
  09156 Nervous system
   04724 Glutamatergic synapse
    111139613
   04727 GABAergic synapse
    111139613
   04725 Cholinergic synapse
    111139613
   04728 Dopaminergic synapse
    111139613
   04726 Serotonergic synapse
    111139613
   04720 Long-term potentiation
    111139613
   04730 Long-term depression
    111139613
   04723 Retrograde endocannabinoid signaling
    111139613
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111139613
  09159 Environmental adaptation
   04713 Circadian entrainment
    111139613
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111139613
   05206 MicroRNAs in cancer
    111139613
   05205 Proteoglycans in cancer
    111139613
   05231 Choline metabolism in cancer
    111139613
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111139613
   05214 Glioma
    111139613
   05223 Non-small cell lung cancer
    111139613
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111139613
   05022 Pathways of neurodegeneration - multiple diseases
    111139613
  09165 Substance dependence
   05031 Amphetamine addiction
    111139613
   05032 Morphine addiction
    111139613
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111139613
   05161 Hepatitis B
    111139613
   05171 Coronavirus disease - COVID-19
    111139613
   05163 Human cytomegalovirus infection
    111139613
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111139613
   05143 African trypanosomiasis
    111139613
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111139613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111139613
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     111139613
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   111139613
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 111139613
NCBI-ProteinID: XP_022347647
UniProt: A0A2Y9IG42
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPAIRAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPVSPPPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctgggggattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccgaaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgtgaccactgcggctccctt
ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggggtggaccacacggagcgccgtgggcgg
ctgcagctagagatccgagcaccgacggcagatgagatccacgtcacagttggtgaggcc
cgtaatctcatcccaatggatcccaatggtctgtcggatccctatgtgaagctgaagctt
atcccagaccctcggaacttgacaaaacagaagacccggacggtgaaagccacactaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccaggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaacgacttcatgggtgccatgtcc
ttcggggtctcagagctgctcaaggccccggtggatggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccggtggctgacgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactctatgagcgcgtgcggatgggtccctct
tcttctcccatcccttccccatcccccagtcccaccgactccaagcgctgtttctttggg
acgagccccggacgtctccacatctctgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggctgagcgcaggggctccgatgagctctatgccatcaag
atcttgaagaaagacgtgattgtccaggacgacgacgtggactgcaccctcgtggagaag
cgagtgctggccctggggggccgaggcccggggggccggccccactttctcacccagctg
cactccaccttccagaccccggatcgcctgtatttcgtgatggagtatgtcaccgggggc
gacttgatgtaccacattcagcagctgggcaagtttaaggagccccatgccgcgttctac
gcagcggaaatcgccatcggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaactagacaacgtcatgctggatgccgaaggacacatcaaaatcactgacttcggc
atgtgtaaggagaacgtcttcccggggaccacgacccgcaccttctgtgggaccccagac
tacatagcccctgagatcattgcctaccagccctatgggaagtctgtggattggtggtcc
tttggggttctgctgtatgagatgctggcaggacagcccccttttgatggggaggatgag
gaagagctgtttcaggccatcatggaacaaactgtcacttaccccaagtcgctttcccga
gaagccgtggcgatctgcaaggggttcctaactaagcacccagcgaaacgcctgggctca
gggcccgacggggagcccgccatccgtgctcatggctttttccgctggatggactgggag
cgcctggaacggctggagatagcgcctcctttcagaccccgtccgtgtggacgcagcggc
gagaacttcgacaaattcttcacgcgggcggcgcccgcgctgaccccgccggaccgccta
gttttggccagcatcgaccaggccgacttccaaggcttcacctacgtgaacccggatttc
gtgcaccccgacgcccgcagccccgtcagcccaccgcctgtgccagtcatgtaa

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158087
Entry
111158087         CDS       T05871                                 

Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04650  Natural killer cell mediated cytotoxicity
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04670  Leukocyte transendothelial migration
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111158087
   04012 ErbB signaling pathway
    111158087
   04014 Ras signaling pathway
    111158087
   04015 Rap1 signaling pathway
    111158087
   04310 Wnt signaling pathway
    111158087
   04370 VEGF signaling pathway
    111158087
   04066 HIF-1 signaling pathway
    111158087
   04020 Calcium signaling pathway
    111158087
   04070 Phosphatidylinositol signaling system
    111158087
   04072 Phospholipase D signaling pathway
    111158087
   04071 Sphingolipid signaling pathway
    111158087
   04151 PI3K-Akt signaling pathway
    111158087
   04150 mTOR signaling pathway
    111158087
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111158087
   04540 Gap junction
    111158087
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111158087
   04664 Fc epsilon RI signaling pathway
    111158087
   04666 Fc gamma R-mediated phagocytosis
    111158087
   04670 Leukocyte transendothelial migration
    111158087
  09152 Endocrine system
   04911 Insulin secretion
    111158087
   04929 GnRH secretion
    111158087
   04912 GnRH signaling pathway
    111158087
   04921 Oxytocin signaling pathway
    111158087
   04926 Relaxin signaling pathway
    111158087
   04935 Growth hormone synthesis, secretion and action
    111158087
   04918 Thyroid hormone synthesis
    111158087
   04919 Thyroid hormone signaling pathway
    111158087
   04928 Parathyroid hormone synthesis, secretion and action
    111158087
   04916 Melanogenesis
    111158087
   04925 Aldosterone synthesis and secretion
    111158087
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111158087
   04270 Vascular smooth muscle contraction
    111158087
  09154 Digestive system
   04970 Salivary secretion
    111158087
   04971 Gastric acid secretion
    111158087
   04972 Pancreatic secretion
    111158087
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111158087
   04961 Endocrine and other factor-regulated calcium reabsorption
    111158087
  09156 Nervous system
   04724 Glutamatergic synapse
    111158087
   04727 GABAergic synapse
    111158087
   04725 Cholinergic synapse
    111158087
   04728 Dopaminergic synapse
    111158087
   04726 Serotonergic synapse
    111158087
   04720 Long-term potentiation
    111158087
   04730 Long-term depression
    111158087
   04723 Retrograde endocannabinoid signaling
    111158087
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111158087
  09158 Development and regeneration
   04360 Axon guidance
    111158087
  09159 Environmental adaptation
   04713 Circadian entrainment
    111158087
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158087
   05206 MicroRNAs in cancer
    111158087
   05205 Proteoglycans in cancer
    111158087
   05231 Choline metabolism in cancer
    111158087
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111158087
   05214 Glioma
    111158087
   05223 Non-small cell lung cancer
    111158087
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111158087
   05022 Pathways of neurodegeneration - multiple diseases
    111158087
  09165 Substance dependence
   05031 Amphetamine addiction
    111158087
   05032 Morphine addiction
    111158087
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111158087
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111158087
   05161 Hepatitis B
    111158087
   05171 Coronavirus disease - COVID-19
    111158087
   05164 Influenza A
    111158087
   05163 Human cytomegalovirus infection
    111158087
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111158087
   05143 African trypanosomiasis
    111158087
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111158087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111158087
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111158087
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     111158087
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   111158087
Membrane trafficking [BR:elk04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    111158087
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 111158087
NCBI-ProteinID: XP_022375624
UniProt: A0A2Y9KWD6
LinkDB
Position
Unknown
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQTSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccacgag
tttgtcactttttcttgtccgggtgcggataagggacctgacaccgatgaccccagaagc
aagcacaagttcaaaatccacacctatggaagccccaccttctgtgatcactgtggctcc
ttgctgtatggacttattcatcaagggatgaaatgtgacacctgtgacatgaacgtgcac
aagcagtgcgtgatcaacgtgcccagcctctgcgggatggaccacacggagaagcggggc
cgcatctacctgaaggccgaggtcaccgacgagaagctccacgtcaccgtacgcgatgca
aaaaatctaattcctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacagaaaaccaaaactatccgctccacattaaac
ccccagtggaatgagtcttttacgttcaagttaaagccttcggataaagaccgacgactg
tccgtagaaatctgggactgggatcgaacaacaaggaatgatttcatgggctccctttcc
tttggcgtctcggagctgatgaagatgccggccagcggatggtacaagctgcttaaccaa
gaggaaggtgagtactacaatgtgcccattccagaaggggatgaagaaggcaacgtggag
ctcaggcagaagttcgagaaagccaagcttggccctgctggtaacaaagtcatcagtcct
tcagaagacaggagacaaacttccaacaacctggacagagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgctcgctgaccggaagggc
acagaggaactgtatgccatcaaaatcctgaagaaggacgtggtgattcaagatgacgac
gtggagtgcaccatggtggagaagcgagtcctggccctgctggacaagcccccgttcctg
acacagctacactcctgcttccagaccgtggaccggctgtatttcgtcatggaatacgtc
aatggcggggacctcatgtaccacattcagcaagtgggaaaatttaaggaaccacaagca
gtattttatgcagcagaaatttccattggattgttctttcttcataaaaggggaatcata
tacagggatctgaagttagataatgtcatgctggattcggaagggcatatcaagattgct
gattttgggatgtgcaaggaacacatgatggatggggtcaccaccaggaccttctgtggg
acaccggattacatcgccccagagataatcgcgtatcagccgtatggaaaatccgtggac
tggtgggcctacggtgtcctattatatgaaatgctagccgggcagcctccctttgacggc
gaagacgaagacgagctatttcagtccataatggagcataacgtctcttatcccaaatcc
ttgtccaaggaggccgtttccatctgcaaaggactgatgaccaaacacccaggcaagcgg
ctgggttgcgggccagagggggagagggatgtgcgggagcatgccttcttccggaggatc
gactgggagaaacttgagaacagggagatccagccgcccttcaagcccaaagtgtgtggc
aaaggcgcagaaaactttgacaagttcttcacgcgagggcagcccgtcttgacaccaccc
gatcagctggtcattgctaacatagaccagtctgatttcgaggggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagcgcagtatga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111162208
Entry
111162208         CDS       T05871                                 

Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04066  HIF-1 signaling pathway
elk04070  Phosphatidylinositol signaling system
elk04071  Sphingolipid signaling pathway
elk04150  mTOR signaling pathway
elk04270  Vascular smooth muscle contraction
elk04310  Wnt signaling pathway
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04650  Natural killer cell mediated cytotoxicity
elk04662  B cell receptor signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04670  Leukocyte transendothelial migration
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04730  Long-term depression
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04925  Aldosterone synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04931  Insulin resistance
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk04935  Growth hormone synthesis, secretion and action
elk04960  Aldosterone-regulated sodium reabsorption
elk04961  Endocrine and other factor-regulated calcium reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04973  Carbohydrate digestion and absorption
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05032  Morphine addiction
elk05140  Leishmaniasis
elk05143  African trypanosomiasis
elk05146  Amoebiasis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05214  Glioma
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111162208
   04012 ErbB signaling pathway
    111162208
   04014 Ras signaling pathway
    111162208
   04015 Rap1 signaling pathway
    111162208
   04310 Wnt signaling pathway
    111162208
   04370 VEGF signaling pathway
    111162208
   04064 NF-kappa B signaling pathway
    111162208
   04066 HIF-1 signaling pathway
    111162208
   04020 Calcium signaling pathway
    111162208
   04070 Phosphatidylinositol signaling system
    111162208
   04071 Sphingolipid signaling pathway
    111162208
   04150 mTOR signaling pathway
    111162208
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111162208
   04540 Gap junction
    111162208
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111162208
   04662 B cell receptor signaling pathway
    111162208
   04666 Fc gamma R-mediated phagocytosis
    111162208
   04670 Leukocyte transendothelial migration
    111162208
   04062 Chemokine signaling pathway
    111162208
  09152 Endocrine system
   04911 Insulin secretion
    111162208
   04929 GnRH secretion
    111162208
   04912 GnRH signaling pathway
    111162208
   04921 Oxytocin signaling pathway
    111162208
   04935 Growth hormone synthesis, secretion and action
    111162208
   04918 Thyroid hormone synthesis
    111162208
   04919 Thyroid hormone signaling pathway
    111162208
   04928 Parathyroid hormone synthesis, secretion and action
    111162208
   04916 Melanogenesis
    111162208
   04925 Aldosterone synthesis and secretion
    111162208
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111162208
  09154 Digestive system
   04970 Salivary secretion
    111162208
   04971 Gastric acid secretion
    111162208
   04972 Pancreatic secretion
    111162208
   04973 Carbohydrate digestion and absorption
    111162208
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111162208
   04961 Endocrine and other factor-regulated calcium reabsorption
    111162208
  09156 Nervous system
   04724 Glutamatergic synapse
    111162208
   04727 GABAergic synapse
    111162208
   04725 Cholinergic synapse
    111162208
   04728 Dopaminergic synapse
    111162208
   04726 Serotonergic synapse
    111162208
   04720 Long-term potentiation
    111162208
   04730 Long-term depression
    111162208
   04723 Retrograde endocannabinoid signaling
    111162208
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111162208
  09159 Environmental adaptation
   04713 Circadian entrainment
    111162208
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111162208
   05206 MicroRNAs in cancer
    111162208
   05205 Proteoglycans in cancer
    111162208
   05231 Choline metabolism in cancer
    111162208
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111162208
   05214 Glioma
    111162208
   05223 Non-small cell lung cancer
    111162208
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    111162208
   05022 Pathways of neurodegeneration - multiple diseases
    111162208
  09165 Substance dependence
   05031 Amphetamine addiction
    111162208
   05032 Morphine addiction
    111162208
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111162208
   04933 AGE-RAGE signaling pathway in diabetic complications
    111162208
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111162208
   05161 Hepatitis B
    111162208
   05171 Coronavirus disease - COVID-19
    111162208
   05164 Influenza A
    111162208
   05163 Human cytomegalovirus infection
    111162208
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111162208
   05140 Leishmaniasis
    111162208
   05143 African trypanosomiasis
    111162208
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111162208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111162208
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     111162208
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   111162208
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 111162208
NCBI-ProteinID: XP_022382145
UniProt: A0A2Y9LK98
LinkDB
Position
Unknown
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgaa
ttcgtcaccttctcctgcccaggtgccgacaaaggcccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtacggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctgtgcggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacattgagagggaagtcctcatcgtcgtcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagacccttacgtgaaactgaaactg
attcccgaccccaagagcgagagcaagcagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaacgagacattcagattccagttgaaagaatcggacaaagacagaagactg
tccgtggagatttgggactgggatctgaccagcaggaatgacttcatgggatctttgtcg
tttgggatttccgaactgcagaaagctggtgttgatggctggttcaagttgctgagccag
gaggaaggcgagtacttcaacgtgcctgtgccgccagaaggaagcgagggcaatgaagag
ctgaggcagaaattcgagagagccaagatcagtcaggggaccaaggctccggaagaaaag
acgaccaataccatatccaaacttgacaacaatgggaacagagaccgaatgaaactgact
gattttaacttcctgatggtgctcgggaaaggaagctttggcaaggtcatgctctccgag
cggaaaggcacggacgagctctacgccgtgaagatcctgaagaaggacgtggtgatccag
gacgacgacgtggagtgcacgatggtggagaagcgggtgctggccctgccagggaagccg
ccgttcctgacccagctgcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaacgggggtgacctcatgtaccacatccagcaagttggccggtttaaggag
cctcatgctgtattttacgctgcagaaattgccatcggtctgttcttcttgcagagcaag
ggcatcatttaccgtgacctcaaacttgacaatgtgatgctggattcagagggccacatc
aagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgaccactaagaca
ttctgtggaactccagactacatcgcccctgagatcattgcctaccagccctacgggaag
tctgtggattggtgggccttcggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggcgaggatgaggatgagctcttccagtccatcatggaacacaacgtggcttac
cccaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgcctggggtgcggacccgaaggtgaacgcgacatcaaggagcacgcgtttttc
cggtatattgattgggagaaactggagcgcaaagagatccagcccccgtacaagccaaaa
gcctgtgggcgaaatgctgaaaacttcgaccggtttttcacccgccatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccagtcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system