KEGG   Enhydra lutris kenyoni (northern sea otter): 111154673
Entry
111154673         CDS       T05871                                 

Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04370  VEGF signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05010  Alzheimer disease
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05134  Legionellosis
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111154673
   04151 PI3K-Akt signaling pathway
    111154673
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111154673
   04215 Apoptosis - multiple species
    111154673
   04115 p53 signaling pathway
    111154673
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111154673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154673
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154673
   05212 Pancreatic cancer
    111154673
   05215 Prostate cancer
    111154673
   05213 Endometrial cancer
    111154673
   05222 Small cell lung cancer
    111154673
   05223 Non-small cell lung cancer
    111154673
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154673
   05012 Parkinson disease
    111154673
   05014 Amyotrophic lateral sclerosis
    111154673
   05016 Huntington disease
    111154673
   05020 Prion disease
    111154673
   05022 Pathways of neurodegeneration - multiple diseases
    111154673
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111154673
  09171 Infectious disease: bacterial
   05134 Legionellosis
    111154673
   05152 Tuberculosis
    111154673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111154673
   05161 Hepatitis B
    111154673
   05160 Hepatitis C
    111154673
   05164 Influenza A
    111154673
   05162 Measles
    111154673
   05168 Herpes simplex virus 1 infection
    111154673
   05163 Human cytomegalovirus infection
    111154673
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154673
   05169 Epstein-Barr virus infection
    111154673
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111154673
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111154673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111154673
   01002 Peptidases and inhibitors [BR:elk01002]
    111154673
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     111154673
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111154673
Peptidases and inhibitors [BR:elk01002]
 Cysteine peptidases
  Family C14: caspase family
   111154673
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 111154673
NCBI-ProteinID: XP_022370185
UniProt: A0A2Y9KLN3
LinkDB
Position
Unknown
AA seq 475 aa
MDEADRQVLRRCRVQLVNELQVAPLWDVLVTHQLFTPAMIEDIQHAGSGSRSDQARQLVI
DLETRGSQALPLFISCLEDTDQNKLASVLRARRQAEKQNPEVVRPRNPMPVVVGAMGLTP
EDLRGKQGPSKATPGKLAPVVLGPEQLWSAKLRPEVLRPEMPRPVDSGSGRFSDVCAQEI
SKQNADLAYALNADPCGHCLIINNVNFCLESRLTARTGSNIDCEKLRQRFHLLHFMVEVK
CDLTAKQMVQALVELARRDHSALDCCVVVVLSHGCQASHRQFPGAVYGTDGCPVAIERIV
NIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFEVASASPEDRTLGSDPESDAVPFQEGPG
PFDQLDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWAHSEDLQTLL
LRVSVASLWGRRGKAAGRRVSRPLGRREGPAGPRAHTRGSSCTLACRESWCFCFF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggacgaggcggaccggcaggtcctgcggcggtgccgggtgcagctggtcaacgagctg
caggtggccccgctctgggacgttctggtgacccaccagctcttcacgcccgccatgatc
gaggacattcagcatgcaggctcagggtctcggagcgatcaggccaggcagctcgtcata
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
gaccagaacaaactggcttcagtcctgagagcgcgtcggcaagcagaaaagcagaatcca
gaggtcgtcagaccccggaaccccatgcctgtggtggttggagcaatgggcctcacacca
gaggatctcagagggaagcaaggcccatcgaaggcgactcccggaaaactcgctccagtg
gtgctggggcctgagcagctctggtcagccaagctcaggccagaggttctcagaccagag
atgcccaggccagtggacagtggctctggacgattcagtgatgtatgtgctcaggagatt
tccaagcaaaatgctgatttggcctacgccctgaacgcagacccctgcggccactgcctg
atcatcaacaacgtgaacttctgcctcgaatcgaggctcacggcccgcaccggctccaac
atcgactgtgagaagctgcgtcaacgcttccacttgctgcatttcatggtggaggtgaag
tgcgacctgacggccaagcaaatggtccaggctttggtggagctggcgcggcgggaccac
agcgccctggactgctgcgtggtggtcgtcctctcccacggctgtcaggccagccaccgc
cagttcccaggggctgtttatggcacggacggatgtcctgtggccatcgagagaattgtg
aacatcttcaatggagccggctgccccagcttgggagggaagcccaagctcttcttcatc
caggcctgcggtggggagcagaaagaccatgggtttgaggtggcctctgcttcccccgaa
gacaggaccctaggcagtgaccccgagtcagacgctgtcccattccaggaaggcccaggc
ccctttgaccagctggatgccgtgtctagtttgcccacacccagtgacatctttgtgtcc
tactccaccttcccaggctttgtttcctggagggataccaagagcggctcctggtacgtg
gagacgttggatggtgtttttgagcagtgggctcactctgaagatttgcagaccctcctg
ctcagggtgagtgtggcctccctctgggggaggagagggaaggcggctgggaggcgcgtg
agtcgtcctctgggcaggcgggagggtccagcagggccccgggcccacaccagagggtcc
tcgtgcaccttggcttgccgggagagttggtgcttctgcttcttttga

DBGET integrated database retrieval system