KEGG   Esox lucius (northern pike): 105009929
Entry
105009929         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105009929
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105009929
   04370 VEGF signaling pathway
    105009929
   04068 FoxO signaling pathway
    105009929
   04070 Phosphatidylinositol signaling system
    105009929
   04150 mTOR signaling pathway
    105009929
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105009929
  09143 Cell growth and death
   04210 Apoptosis
    105009929
   04218 Cellular senescence
    105009929
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105009929
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105009929
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105009929
   04625 C-type lectin receptor signaling pathway
    105009929
  09152 Endocrine system
   04910 Insulin signaling pathway
    105009929
   04914 Progesterone-mediated oocyte maturation
    105009929
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105009929
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105009929
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105009929
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105009929
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105009929
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd PI3K_p85B DUF2321
Other DBs
NCBI-GeneID: 105009929
NCBI-ProteinID: XP_028973595
LinkDB
AA seq 1070 aa
MAPRPSSGELWGLHLMPPRILVDCCLPNGMLVSLECLREAPLTSIKQQLFTEARKYPLYH
LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEKILNREIGFA
IGMPICEFEQVKDPEVQDFRRSILSVCREAMEEREGGGAHTQALYVYPPNVESAPELPQH
IYCKLDKGRLIVTIWVIVSPSNSKQKYTLKISHDSLPEQLIAEAIRKKTRSMHLSAQQLR
LCVQEYQGQYILKVCGCDEYLLEKYPLSQYKYVRGCITMGRLPHLMLVSKDSLYSQLPGS
GFVAPSYSRRTPQPSPCPGGGDPSTPRSLWAFNTLLRVRLLCATYVNVNIRDIDKIYVRT
GIYHGGEPLCDNVNTQRVPCSNPRWNEWLSYDIYLTDLPRSARLCLSICSVKGRKGAKEE
HCPLAWGNVNLFDYKDTLVCGKVALSLWPVPHGLEDLLNPIGVAGSNPNKETPCVELEFS
WFNQVVLFPDEQQIEEHANWTISRELGYNYCLGLSSRLACDSSVSVADGEQLRSLCSRDP
LYELSEQEKDFLWRHRHYCVNIPESLPKLLLSVKWNSRDEWSQMYCLLRDWPLMQPESAL
ELLDCNFPDPMVREFALRCLVQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKKALT
NQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTL
KQEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAKRPL
WLNWDNPDIMSELLFTNNEVIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVKNSYTIMQIQCKGGLKGALQFNSNTLHHWIKDKNRGEAYDRAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGVQECTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQSFDDI
AYLRKTLALEKSQQEALEYFTKQMNDAHHGGWTTKMDWIFHTIRHMPNEH
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcacctcggccgtcgtcaggtgagctatggggtctccacctcatgcccccccggatc
ctggtggactgctgtctgcccaacggcatgctggttagtctggagtgtctccgagaggct
ccgctcaccagcatcaaacaacagctgttcacagaggcccggaagtaccccctctaccac
cttctacaggaggagtcgtgttacatctttgtgggcgtgacccaggaggcggagagggag
gagttttatgatgagacgcggcgtctgtgtgacctcagactgtttcaccccatcttgaag
gtcattgaaccgctgggcaacagagaagagaaaatactcaacagggagataggctttgca
ataggcatgcctatctgtgagtttgagcaggtgaaggacccggaggtccaggacttcaga
cggagcatactgagcgtgtgcagagaggccatggaggagcgggaggggggtggggctcac
acacaggccctctatgtgtacccccccaatgtagagtcagcccccgagctgccccagcac
atctactgtaaactggacaagggccgtctgatagtgaccatctgggtgatcgtctctcca
tccaactccaaacagaagtacacactgaagatcagccatgacagtctaccagaacaactc
atagctgaggccatcaggaagaagactaggtccatgcatctgtcggcccagcagctcaga
ctgtgtgtccaggagtaccagggtcagtacatcctgaaggtctgtggctgtgatgagtac
ctgttggagaaataccccctcagccagtacaagtatgtccgtggctgtatcaccatgggt
cggctgccccacctcatgctggtgtctaaggacagtctgtatagccagctcccaggcagt
gggtttgtggccccatcctacagccgaaggaccccccagcccagcccctgtcccggggga
ggagaccccagcaccccccgctccctctgggccttcaacaccctgctcagggtccgactg
ctctgtgccacatacgtcaatgtcaacatcagagacatagacaagatctatgttagaaca
gggatctatcatggtggagagccgttgtgtgataatgtcaacacccagagagttccctgc
tccaaccccaggtggaatgagtggttgtcgtatgacatctatctgaccgacctccctcgc
tccgcccgactctgcctgtccatctgctccgtcaagggacgcaagggagccaaggaggag
cactgccccctggcctggggtaatgtcaacctgtttgactacaaggacactctggtctgt
ggtaaagtggctctgagtctgtggccggttccccacggcctggaggacctgctcaacccc
atcggagtggctggatccaaccccaacaaggagaccccgtgtgtggaactggagttctcc
tggttcaaccaggtggttctgttccctgatgaacagcagattgaagaacacgccaactgg
accatctcacgagaactgggatacaactactgtctgggactgagcagccgcttggcctgt
gacagcagtgtatcagtggcggatggagaacagctgcggtccctgtgtagcagagatcct
ctctatgagttgtctgagcaggagaaagacttcctctggagacacagacattactgtgtc
aacattcccgagtctcttccaaagctgctgctctcagtcaaatggaactccagggacgaa
tggtcacagatgtactgcctgttgagggactggcctttgatgcagccagaaagtgcattg
gagctgttggactgtaactttcctgacccgatggttcgggagttcgccctacgctgcctc
gtacagggtctcaccgacgacaaactgagccagtaccttctacagctagtacaggtgttg
aagtatgagatgtacctggacaaccctctggctcgcttcctcatcaagaaagctctgacc
aatcagaggataggacacttcttcttctggcatcttaagtcagagatgcataacaagact
gtgtccagaaggtttggtcttctgttggaggccttttgcagagcctgtgggatgtacctc
aaacatctcaacagacaggtggaggcgatggacaaactggtgaaccttacagacactctg
aaacaggagaagaaagacgaaacccagaagacccagatgaagttcctggtagaacatatg
tcccgcccagactacatggaggctctgcaaggctttgtctctcccctcaaccctgttcac
cagctgggcaacctcaggctggaggagtgcaggatcatgtcatcagccaaacgtcctctg
tggttgaactgggacaatcctgacatcatgagtgaactcctgtttaccaacaacgaggtg
atcttcaagaacggagacgatctccggcaggacatgttgactctgcagattattaagatt
atggagaatatctggcagaaccagggactggacctgaggatgctgccgtacggctgtctg
tctataggcgactgtgttggtctgatcgaggtggtgaagaacagctacaccatcatgcag
atccagtgtaaaggaggcctaaagggggcgctgcagttcaacagcaacactctgcatcac
tggatcaaagacaaaaacagaggagaggcttatgacagagcgatagacctgttcacgcgg
tcctgtgcaggatactgtgtagccaccttcatcctggggattggggacagacacaactcc
aacatcatggtcaaggagaatggccagctgttccatatagactttggtcacttcctggat
cataagaagaagaagtttggctacaagagggagagggttccatttgttctgacacaggac
ttcctcatcgtcatcagcaagggtgtccaggagtgtaccaagaccaaggaatttgagagg
ttccaggagatgtgttacaaggcctacctggccatccggcaacacgcctctctcttcatc
aacctgttctctctgctgctgggctgtggcatgcctgaactacagtcctttgatgacatt
gcctacctgaggaagaccctggctctggagaagagccaacaggaggcgctggagtacttc
accaagcagatgaacgatgcccatcatggaggctggaccactaagatggactggatcttc
cacacaatcagacacatgcccaatgaacactga

KEGG   Esox lucius (northern pike): 105015144
Entry
105015144         CDS       T04894                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105015144 (pik3r1)
   04370 VEGF signaling pathway
    105015144 (pik3r1)
   04068 FoxO signaling pathway
    105015144 (pik3r1)
   04070 Phosphatidylinositol signaling system
    105015144 (pik3r1)
   04150 mTOR signaling pathway
    105015144 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105015144 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    105015144 (pik3r1)
   04218 Cellular senescence
    105015144 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105015144 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105015144 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105015144 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    105015144 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105015144 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    105015144 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105015144 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105015144 (pik3r1)
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105015144 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Lant_dehydr_C RNA_binding Transcrip_act BRE1
Other DBs
NCBI-GeneID: 105015144
NCBI-ProteinID: XP_010876351
UniProt: A0A3P8XRD3 A0A3P8ZQB2
LinkDB
AA seq 728 aa
MAAEGYQYRALYDYKKEREEDIDLHVGDILTVTKGALVALGYNDGLEERPEDIGWLPGFN
ETTQEKGDFPGTYVEFIGKKRISPPTPKPRPPRPLPVAPGSSKADSGDEQGSALLDLTEQ
FAPPETAPPMLARLLEAIERKGLDNPTLYQTFTAGGGLDVRQCFDTDPPSPDLDQMDLQM
LCDGLRRYLQDLPQPVIPVVIYAQLVHTAQEVQNPEECAQLLRRIASAPSLPVQYWLTLH
CLLRHWSRVCHNAPKNRLSSRALGEIFSPMLFRQQSTSCEPSPDAHIKIIETLVTSEWTE
AQAAPALPPKPPKPTPPVVANNGMNNSMALQDAEWYWGDISREEVNEKLRDTADGTFLVR
DASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNP
KLDVKLQFPVSKHQQDQVVKEDNIEAVGKKLHEYHQQYQEKNREYDRLYEEYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYEKLKSRISEI
VDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWL
DIKNENTEDQYSMVDDDEDLPHHDERSWKLGNINRLQAEALLRGKRDGTFLVRDSSKAGC
YACSVVVDGEVKHCVINKTPSGFGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAH
PVYAQQRR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggctgcagaaggatatcagtacagggcgctttatgactacaaaaaggagagagaggag
gacattgacctccatgtgggggacattttaacagtgactaaaggggcactggtggccctt
gggtacaacgatggcctggaggaaaggcctgaagatattggctggctgcctggctttaat
gaaaccactcaggaaaagggggacttccctgggacatatgttgagttcattgggaagaag
cggatctctcctcccactcccaagccaagacccccaaggcccttacctgttgcgccaggc
tcatccaaggcagactctggtgatgaacaaggttcagccctactggacctgacagagcag
tttgctcccccagagacggctcccccaatgctggcacggctactggaggccatcgagagg
aaaggtctagataacccaacactgtaccaaaccttcacagccggtggtggacttgatgtc
cgacagtgctttgacactgatcctccgtctccagacctggaccagatggacctgcagatg
ctgtgtgatggtctccgtcggtacctgcaggatcttccccagcctgtcatcccagtggtc
atttacgctcagctggttcacaccgcccaagaggtgcagaacccagaggagtgtgcccag
ttgctgcgacgcatcgccagcgcgcccagcttgccggtgcaatactggctcaccctgcac
tgcctgctgcgccactggtcccgggtgtgtcacaacgcacccaagaatcggctcagctcc
cgtgccctgggcgagatctttagcccaatgctcttcagacagcagtccactagttgtgag
cccagcccggatgctcacattaagatcattgagacccttgtgactagtgaatggactgaa
gcccaggcagctccagcactacctcccaagccacccaaacccacaccccctgttgtcgct
aacaacggtatgaacaacagcatggcgctgcaggatgctgagtggtactggggagacatc
tcccgcgaggaggtcaacgagaagctgagggacacggctgatggcacatttttggtccgt
gacgcctccaccaagatgcatggtgactacacgctcacactgagaaaagggggtaataat
aagctgatcaagatattccaccgggatgggaagtatggcttctcagaccccctgaccttt
aactcagtggtagagcttatcaaccactaccgcaatgagtccctggctcagtacaacccc
aaactagatgttaagctgcagtttcctgtctctaagcaccagcaggatcaggtggtgaag
gaggacaacatcgaggctgtgggcaagaagctccacgagtaccaccagcagtaccaggag
aagaacagggagtatgaccgtctctatgaggagtacacccggacatcccaggaaattcaa
atgaaaagaacagcaattgaagcattcaatgaaaccatcaaaatctttgaggagcaatgc
caaacccaagagcggtacagcaaggagtacatagagaagttcaggagggaaggcaatgac
aaggagatccagcgtatcatgggaaactatgagaagctgaagtctcgtatcagtgagatt
gtggacagcaagcggcgtctggaggaggacttgaagaagcaggctgctgactacagagag
attgacaaacggatgaacagcatcaagccagacctcatccagctccgtaagactagggat
cagtatctcatgtggttgacccagaagggagttaggcagaagaaactcaatgagtggctg
gatatcaagaacgagaacacggaagatcagtactctatggtggatgacgatgaggaccta
ccccaccatgatgagcgctcctggaagctgggcaacatcaaccggctgcaggctgaggcc
ctccttcgggggaagagagacggaacattcctggtccgagacagcagcaaggcagggtgc
tatgcctgcagtgttgttgtggacggtgaagtgaagcactgtgtcatcaacaagacgccc
tctgggtttggctttgcagagccttacaacctgtacagctcactcaaagaacttgtcctc
cactaccagcacacgtcgttggtccagcacaatgactctctgaatgtgacgctagcgcat
cccgtttacgcacagcagcggcggtga

KEGG   Esox lucius (northern pike): 105021974
Entry
105021974         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105021974
   04370 VEGF signaling pathway
    105021974
   04068 FoxO signaling pathway
    105021974
   04070 Phosphatidylinositol signaling system
    105021974
   04150 mTOR signaling pathway
    105021974
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105021974
  09143 Cell growth and death
   04210 Apoptosis
    105021974
   04218 Cellular senescence
    105021974
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105021974
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105021974
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105021974
   04625 C-type lectin receptor signaling pathway
    105021974
  09152 Endocrine system
   04910 Insulin signaling pathway
    105021974
   04914 Progesterone-mediated oocyte maturation
    105021974
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105021974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105021974
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105021974
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF4201 SH2_2 Spc7 Exonuc_VII_L
Other DBs
NCBI-GeneID: 105021974
NCBI-ProteinID: XP_010888345
UniProt: A0A3P8ZG16
LinkDB
AA seq 480 aa
MFYPSEVQFYIEMDQSPPALPPRSTKPVTSSINNLCLREPPVYPLQDAEWYWGDISREEV
NEKLRDTPDGSFLVRDASTKTKGDFTLTLRKDGHNKLIKIYHREGKYGFSEPLSFSSVVE
LIWHYQHHPLVEYNAVLDVMLTHPVSRLQQDELVKEDSVDLAGRKLQEYHSQYQEKSQEF
DRLYESYTKTSQEIQMKRTAIEAFNETMLIFEEQCREQERYGEECERSSRSEGTEKDLES
FLMNYEKLKSRLGEIYNSKVHLETDLRNQVQDYRETDRRINSLRPDLLELRNIRDQYLNW
LNHKGVRQKRINDWLGIQDESSDDTYVLEGERLAHHDEGTWFVGELSRMQAEEMLTDKPT
GTFLIRESSKQGCYACSVVVNEEVKHCMIYSTPHGYGFAEPYDLHCSLKELVLHYRLNSL
AQHNQALDVRLAHPVHVTPVLSASSHTATEDCLLLPTEEHHVLHTPAKLPAGLPAAAPEM
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgttttatccctctgaagtacaattctacatcgaaatggatcagtcacctccagctctc
cctcccaggtcaacaaagcctgtgacatcctccataaacaacctctgccttcgtgaaccc
ccagtctatcctctgcaggatgcagagtggtactggggagacatttccagggaggaagtt
aatgagaagctacgcgacacacccgacggttcgttcctggttcgtgatgcttccactaag
acaaaaggagacttcacactaacgctgaggaaagatggccacaacaagctgatcaagatc
taccaccgcgagggaaagtacggcttctcagagcccctgtccttcagctcagtggtagaa
ctcatctggcactaccagcatcatcctctggtggagtacaatgccgtgctggatgtcatg
ctcacacaccctgtatcccgcctccaacaggatgagctagtgaaggaggacagtgttgac
ttggctggtaggaagctccaggagtaccacagccaatatcaggagaagagtcaagaattt
gaccgtctgtacgaatcctacacaaaaacctcccaggagatccagatgaagcgaaccgcc
atagaggccttcaatgagaccatgctgatcttcgaagagcagtgtcgtgagcaggagcgt
tatggggaggagtgtgagaggagcagtcgatctgagggaacagagaaggacctggagagt
ttcctgatgaactatgagaagctgaagtcccggctgggggagatctacaacagtaaggtc
cacctggaaacggacctgaggaaccaggtccaggactacagagagacagacaggaggatc
aatagccttaggcctgacctccttgagctgcgcaacatcagggaccagtatctcaattgg
ttgaatcacaaaggagtacgacagaaacgcataaatgattggctggggatccaagacgaa
agcagtgatgacacctacgtgttggagggggaaaggctggcccaccatgacgagggtacc
tggtttgtgggcgagcttagtaggatgcaggctgaggaaatgctgacggacaaacccacc
ggaaccttcctgatcagagagagcagcaaacagggctgctacgcctgctctgtagttgtt
aatgaagaggtaaaacattgcatgatatacagcactccgcatggctacggctttgctgag
ccctatgacctccactgctctctgaaggagcttgttttgcactaccgcctcaactccctg
gcacagcacaaccaggccctggatgtccggctggctcaccccgtccacgtaactcctgtc
ttgtcagcctcgtcccacacagccacagaggactgcctgctactgccgacagaggaacac
catgtactacatactcctgctaaactacctgcaggactccctgcagccgctccagagatg
tag

KEGG   Esox lucius (northern pike): 105024545
Entry
105024545         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105024545
   04370 VEGF signaling pathway
    105024545
   04068 FoxO signaling pathway
    105024545
   04070 Phosphatidylinositol signaling system
    105024545
   04150 mTOR signaling pathway
    105024545
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105024545
  09143 Cell growth and death
   04210 Apoptosis
    105024545
   04218 Cellular senescence
    105024545
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105024545
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105024545
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105024545
   04625 C-type lectin receptor signaling pathway
    105024545
  09152 Endocrine system
   04910 Insulin signaling pathway
    105024545
   04914 Progesterone-mediated oocyte maturation
    105024545
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105024545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105024545
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105024545
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP DUF5638 Bap31_Bap29_C OB_RNB
Other DBs
NCBI-GeneID: 105024545
NCBI-ProteinID: XP_028977383
LinkDB
AA seq 511 aa
MPQVNHQLLVHLIRHLVRVAQSGAQNQASPRLLGQAFSEAIFKHSHLSADVNPEHHMKIM
EALITAGGLVEMQAAPALPPKPVKAVPPVSSSGGVKEGAGGSLQEAEWYWGDISREEVND
KLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFSSVVELI
SHYRHESLAQYNTKLDVKLMYPISRYQQDQLVKEDNIDAVGKKLQEYHNQYQEKSKEYDR
LYEEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYIERFRREGNDKEIERIM
MNYEKLKSRLGEIHDSKIRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLN
HKGVRQKRINDWLGIKNENTDEGYFVSTEEDENLPHYDEKSWFVGDLNRTQSEDLLLGKP
DGAFLIRESSKKGCYACSVVVEGEVKHCVIYSTPRGYGFAEPYNLYSSLKDLVLHYHQTS
LVQHNDSLNVRLAYPVYAQTPPSSSGPAPRR
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgcctcaggtcaaccaccagcttctggtgcacctcatcagacacctggtcagagttgcc
cagagtggggctcagaaccaggccagccccaggcttctaggccaggcttttagtgaggcc
attttcaaacactcccacttaagtgcggacgtgaacccggagcaccacatgaagatcatg
gaggccctgattacagctgggggactagtggagatgcaggcagccccagctcttccccct
aagccggtaaaggccgtgcctccagtgagcagcagcggcggtgtgaaggagggggctggg
gggtcactacaggaggctgagtggtactggggagacatatcaagggaggaagtgaatgat
aagttgagagacatgcctgatggtactttcctggttcgggatgcctccaccaaaatgcag
ggcgactatacactaacactaaggaaagggggaaacaataagttgataaagatctaccat
cgggacgggaagtatggtttctcggatcccctgacgtttagctctgtggtggagctgatc
agtcactacagacacgagtctctggcccagtacaacaccaagctagacgtcaaactcatg
taccccatctcccgctaccagcaggatcagctggtgaaagaggacaacattgacgcagtg
gggaagaaactccaggaatatcacaatcaataccaggagaagagcaaggagtatgaccgc
ctttatgaagagtacacaaagacctcccaggagattcagatgaagaggacggccatcgag
gccttcaacgagaccatcaagatctttgaggagcagtgtcacacgcaggaacgctacagc
aaagagtacattgagcgcttccgtagggagggcaacgacaaggagattgagagaatcatg
atgaactatgagaagctcaagtctcgtctaggtgagatccatgacagtaagattcgactg
gagcaggacctgaagacccaggctctggacaacagagagacggacaaaaagatgaacagc
ctcaaacctgacctcatccagctccgcaagatcagggaccagtaccttgtctggctcaat
cacaaaggagtgcgtcagaaacgaattaacgactggctggggataaagaatgagaacaca
gatgagggatactttgtgagtacagaggaggatgagaacctgccccactacgatgagaag
agctggtttgtaggagacctgaacagaacccagtctgaagaccttctactgggcaaacct
gacggagcctttctcataagagaaagtagcaagaagggctgctacgcgtgctctgtcgtt
gtggaaggtgaggtgaagcactgcgtgatctacagcactccgaggggctacggcttcgct
gagccctacaacctgtacagctctttgaaggacctggtcctgcattatcaccagacgtcc
ctggtacagcacaacgactcgctcaacgtgcgcctggcctaccccgtctacgcacagacg
cccccgtcgtcctccggccctgccccacggagatga

KEGG   Esox lucius (northern pike): 105025378
Entry
105025378         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105025378
   04370 VEGF signaling pathway
    105025378
   04068 FoxO signaling pathway
    105025378
   04070 Phosphatidylinositol signaling system
    105025378
   04150 mTOR signaling pathway
    105025378
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105025378
  09143 Cell growth and death
   04210 Apoptosis
    105025378
   04218 Cellular senescence
    105025378
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105025378
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105025378
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105025378
   04625 C-type lectin receptor signaling pathway
    105025378
  09152 Endocrine system
   04910 Insulin signaling pathway
    105025378
   04914 Progesterone-mediated oocyte maturation
    105025378
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105025378
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105025378
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105025378
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 SH3_2 SH3_9 Laminin_I Transcrip_act V_ATPase_I
Other DBs
NCBI-GeneID: 105025378
NCBI-ProteinID: XP_010894308
UniProt: A0A3P8XTJ6
LinkDB
AA seq 721 aa
MSYEGYQYRALYDYKKEREEDIDLHIGDILVVSKGALLALGATNGAEEKPEEIGWLPGFN
ETTQEKGDFPGTYVEFVGRKRISPPTPKPRPPRPLPSTSGLVRTDAESEGFMLPDLPEQF
APPETSSPILVKLLGAIEAKGLECPTLYRTFTATCGLDTRQFADCDLEPLDLQSLCDGLW
RYLQDLPNPVVPIPIQSEMIHAAQEVKDPEECAQLLRRIASSPTHPPQYWLTLYCLIKHF
CRISQNTSKNQLTVRDLAEIFSPVLFRLQPASCEASPDSLIKILEILVNSELSETQAAPA
LPPKPPKPSTPVPNNGFNNNMALQDGEWYWGDISREEVNEKLRDTADGTFLVRDASTKMH
GDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVRLL
YPVSRLQQDQVVKEDNIEAVGKRLHEYHLQFQEKNREYDRLYEEYTRTSQEIQMKRTAIE
AFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYDKLKSRISEIVDSKRHL
EDDLKKQAADYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGINTEHS
EDEYSMVEDDEDLPHNDERSWRLGNIKRQQAEGLLRGKRDGTFLVRDSSKAGCYACSVVV
DGEVKHCVINKTHTGYGFAEPYNLYGSLKELVLHYHHTSLVQHNDSLNVTLAYPVYAHQR
R
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgagttacgaaggataccagtacagagcactttatgactataaaaaggagagagaagag
gacattgatttacatataggggatatactggtggtcagtaagggtgctttgctagccctt
ggtgccactaatggagctgaagaaaaacctgaggagattggttggctgccaggattcaat
gagacaactcaggagaaaggtgactttcccgggacttatgtagagtttgtgggaagaaaa
aggatttcacccccaacaccaaaaccaaggcctccaagacctcttccttccacatcaggt
ttagtccggacggatgccgaatcagagggcttcatgttgccagatctgcccgagcagttt
gctccaccagagacctcatcgcccatcctggtcaagcttctcggggccatagaagccaaa
ggtttggaatgtcccaccctttaccggacgttcacagcgacttgtgggctggatacgaga
cagtttgccgactgcgacctggagcctttagatttacagtcgctatgtgatggcctttgg
cgatacctgcaggatttgccaaatccagttgttcccatcccaattcaaagtgagatgatt
cacgcagcacaagaggtaaaggacccagaggagtgtgcccaattgctgcgcaggatagcc
agctcgcccacccacccgccccagtactggctcactctttactgcctcatcaagcacttc
tgccgtatttctcagaacacaagcaaaaaccagctcactgtcagggacctggctgaaatc
ttcagccctgtgcttttcaggcttcaaccagcaagctgtgaggccagcccggattccctc
atcaagatcctagagatattggttaacagtgaactgagtgaaactcaggcagccccagct
ctcccccctaagccaccaaagccatctaccccggttccgaacaacggcttcaacaacaac
atggccttgcaggacggggagtggtactggggagacatctcaagagaggaggtgaatgag
aagctgcgagacacggctgacggtacgtttctggtccgagacgcgtccacaaaaatgcac
ggagactacacactgacactaaggaaaggaggaaataacaagctgatcaaaatattccac
cgtgacggaaaatacggcttctcggaccccctgaccttcaactcggtggttgagctcatc
aatcactacagacacgagtccttagcccagtacaaccccaagctggacgtgagactgctg
tacccagtgtcgaggctccaacaggatcaggtcgttaaagaggacaacatcgaagctgtt
ggaaaaaggttgcatgagtaccacctgcagttccaggagaagaaccgagagtatgaccgc
ctgtacgaggagtataccagaacgtcccaggaaatccaaatgaagagaactgccatcgag
gcattcaatgaaactattaagatctttgaggagcagtgtcagacccaagagcgctacagc
aaggagtatattgaaaagttcaggagagagggcaacgataaagaaatccagagaatcatg
ggaaactacgacaaactaaaatcgaggatcagcgagattgtggacagcaagcgtcacctg
gaggacgacctgaagaagcaagcggcggactatagagagatcgacaagaagatgaacagc
atcaagcctgacctcatccagctccgcaagaccagagaccaatacttaatgtggctgaca
cagaagggcgtgaggcagaagaagctgaacgaatggctcgggatcaacactgaacactca
gaagacgagtactccatggttgaagatgacgaagacctcccgcacaatgatgagcgttca
tggaggcttggcaacatcaaaaggcagcaggctgaagggctgctccgagggaagcgggac
gggaccttcctggtccgggacagcagcaaagcgggctgctacgcctgcagtgttgttgtt
gacggcgaggtgaagcattgtgtcataaacaagacgcacacaggctatggatttgccgag
ccgtataacttgtatggctccctaaaagaactagtcctgcactaccatcacacgtcactt
gtacagcacaatgactctttaaacgtcacgctggcctacccggtttacgcccatcagagg
aggtga

KEGG   Esox lucius (northern pike): 105025897
Entry
105025897         CDS       T04894                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105025897 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105025897 (pik3ca)
   04370 VEGF signaling pathway
    105025897 (pik3ca)
   04068 FoxO signaling pathway
    105025897 (pik3ca)
   04070 Phosphatidylinositol signaling system
    105025897 (pik3ca)
   04150 mTOR signaling pathway
    105025897 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105025897 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    105025897 (pik3ca)
   04218 Cellular senescence
    105025897 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105025897 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105025897 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105025897 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    105025897 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105025897 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    105025897 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105025897 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105025897 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105025897 (pik3ca)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105025897 (pik3ca)
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105025897 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15 C2
Other DBs
NCBI-GeneID: 105025897
NCBI-ProteinID: XP_010895234
LinkDB
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRIFVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDANGPHSRALYVYPPNVESTQELPKH
IHGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPTD
CFSMPSYARRISTATAYMNGETSTKSLWTINGTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLAYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDYF
SSAVKFPDMATVEEHANRTISRELGFNYSQSGQSKRVARDHALTDIDNEQLRQVCNRDPL
SEITEQEKDFLWRHRHYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNYPDPMIRHFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKRALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNIRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLLYGCMS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKGEMYDMAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcctagaccatcttctggtgagctatggggcatccatttgatgccccccaggatc
tttgttgattgcttgttaccaaacgggatgatcctgaccctggagtgcctccgtgaggct
acgctcatcaccatcaaacatgaactgttcaaggaggccaggaagtatcccctgcatcac
ctgttacaggaggagacatcctacatctttgtcagtgttactcaagaggcagagcgtgag
gagttctatgacgaaactcgaagactatgtgatctcagactctttcaaccttttctgaaa
gtcattgaacctgttggcaaccgggaggagaaaattctgaaccgagaaattggatttgct
attggtatgcctgtgtgtgagtttgacttagtaaaggaccccgaagtgcaggacttcagg
aggaatattcttaatgtctgtaaggattcggtagaactccgagatgccaacggacctcat
agtcgggctttgtatgtttaccctcccaacgtggaatcgacacaagaacttccaaagcac
atccatggcaaactcgacaaaggtcaaatcattgtggtgatctgggtgatcgtgtctccc
aacaacgacaagcagaagtacaccctgaagatcaaccatgattgtgtgccagagcaggtg
atagccgaggccatcaggaagaagactcggagcatgctgttgtccgcagaacagctcaag
atgtgtgtgcaggagtaccagggcaagtacatcctgaaggtgtgcggctgtgacgagtac
ctcttggaaaaataccccctgagtcaatataagtacgtgcggagttgcattatgcttggt
cggatgccaaaccttatgctgatggcaaaggatagcctttactcacagttgcccaccgac
tgcttctccatgccatcctacgcccggcgcatctccaccgccaccgcctacatgaatgga
gagacctccaccaagtccctgtggaccatcaatggcacgctgcgaatacgagtgctttgt
gccacctacgttaacgtcaatatccgggacatcgataagatttatgtacgaactggcatc
taccacggaggtgaacagatgtgtgacaatgtcaacacgcagcgagttccctgctctaat
cccaggtggaacgagtggctggcttacgacatgtacattcccgacatcccccgtgcggca
cgcctctgcctctccatctgctctgtgaaaggcaggaaaggggctaaggaggagcattgt
ccactggcgtgggggaatgtcaatctattcgactacactcacacgctggtttctgggaag
atggctctgaacctgtggcctgtgccgcatggcctggaggacctgctcaatcccatcgga
gtcacaggctccaaccccaacaaggaaacgccttgtttagagctggagtttgactacttt
agcagtgctgtcaagttcccagacatggccacggtggaggaacatgctaaccggaccata
tccagggaactgggcttcaactactcccagtcaggacagagtaaaagagtggcgcgagac
catgccttaacagacattgataatgagcagctgagacaggtctgcaacagagatcccctg
tctgaaatcacagaacaggagaaggacttcctatggaggcacaggcactactgtgtaaat
atacctgaaatcctgcccaagattctactggctgtgaagtggaactcaagagatgaagta
gcgcagatgtattgcctcctgaaggattggccagcaataaaacctgagcaggccatggag
ctgctggactgtaactatccagacccaatgatccgacactttgcggttcgctgccttgag
aagtacttgaccgacgacaaactctctcagtacctcattcagttggttcaggttctgaag
tacgagcaataccttgataaccccctagtacggtttttgctgaaacgggccctgacaaac
caaaggataggacacttctttttctggcacttaaagtcagagatgcacaacaagacagtg
agccagcgatttggccttctgctggagtcctactgccgggcctgcggcatgtacctgaag
cacttgagcaggcaggtggaggccatggagaaactcatcaatctcacagacatcctcaaa
caggagaagaaggatgagactcagaaggtgcagatgaagttcctggtggagcagatgagg
aggccggactacatggatgccctgcagaacttcacctcccccctcaaccccgcacaccag
ctgggaaacatacggcttgaggagtgcagaattatgtcgtctgctaaaagacccctgtgg
ctcaactgggaaaacccagacatcatgtccgagctcctcttccagaacaatgagatcata
ttcaaaaacggagacgacctgcggcaggacatgctaacactccagatcatcagaatcatg
gagaacatctggcagaaccagggtctggacctcaggatgttgctgtatggctgcatgtcc
atcggggactgtgtgggcttaatcgaggtggtgcgaagctctcacaccatcatgcagatc
caatgtaaaggaggcctgaagggggcgctgcagttcaacagctcaacactacaccagtgg
ctcaaagacaagaacaagggagagatgtacgacatggcggttgacttgtttacccggtca
tgtgctggttactgcgtggccaccttcattctggggattggggatcggcacaacagcaac
atcatggtcaaggacgatgggcagctgttccacatcgattttggacatttcctggaccac
aagaaaaagaaatttggctacaagcgagagcgagttccatttgtcctaacccaagacttc
ttgatagtgatcagcaaagggacccaggagtgcacaaagaccagagagtttgagaggttc
caggagatgtgctataaggcatacttggcaatccgtcagcatgccaacctcttcatcaac
ctgttttccatgatgctgggctccgggatgcccgagctgcagtcttttgacgacatcgcc
tacatccgtaagaccctggcgctggacaagacggagcaggaggccctggactacttcatg
aaacagatgaacgacgcccaccatgggggctggaccaccaagatggactggatcttccac
accatccgccagcacgcactcaactga

KEGG   Esox lucius (northern pike): 105026229
Entry
105026229         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105026229
   04370 VEGF signaling pathway
    105026229
   04068 FoxO signaling pathway
    105026229
   04070 Phosphatidylinositol signaling system
    105026229
   04150 mTOR signaling pathway
    105026229
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105026229
  09143 Cell growth and death
   04210 Apoptosis
    105026229
   04218 Cellular senescence
    105026229
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105026229
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105026229
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105026229
   04625 C-type lectin receptor signaling pathway
    105026229
  09152 Endocrine system
   04910 Insulin signaling pathway
    105026229
   04914 Progesterone-mediated oocyte maturation
    105026229
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105026229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105026229
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105026229
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Lant_dehydr_C PI_PP_I V_ATPase_I
Other DBs
NCBI-GeneID: 105026229
NCBI-ProteinID: XP_028977574
LinkDB
AA seq 727 aa
MAVEGFQFRALYVYNRDLEEDLDLQPGDILTVSKASLASLGLKDGDEEHPARMGWIVGIN
ERTKQRGDFPGTYVQYVGTVKMFVMPNQPRQQRPLPAVPRPQPPPSQQGTSTLRDFFLPF
SSLENIPPTLVKLVEAIERKGLEGETLYRTSGSSAAGGQRPSLNLDLPESEMGQHDVRGL
TEALLGFLRDLPSPVIPESVYPSLRSALNEGAELSVEDSGRRLLKELVPPAVPAASLLTL
QYLLRHLDRVAQRAECNGLDPASLSLLFTPLLFSAGSEEDHLFSVQVLERLLVARAWELE
QMPPALPPKPSKTKAVASSVISGDGGKMADAEWYWGDISREEVNEKMRDTPDGTFLVRDA
SSKVQGEYTLTLRKGGNNKLIKIFHRGGKYGFSEPLTFSSVVELILHYHHESLAQYNPKL
DSRLLYPVSKFQQDQMVKEDNVEAVGEQLKVYHEQYQEKSQAYDILYEEYTRTSQELQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYMEKFQREGNSKEMERIQSNSNKLKSRVTEIHD
SKRRLEQDLKEEAADNREIDKKMNSLKPDLMQLRKIRDQYLVWLNQKGTRQRKINEWLGI
KNDIEDVYSLVDEEEDLPHHDERTWYVGNIKRGQAEELLRGKDDGTFLIRDSQSQKGSYA
CSVVVDRDIKHCVIFKTSTGYGFAEPYNLYASLRELVLHYRHTSLVQHNDSLNVTLAFPV
LTQQQTR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggctgtagaaggtttccaatttcgagcgctgtatgtctacaacagagatttggaggag
gaccttgacctccagcctggggacatactgaccgtcagcaaggcgtcactggcgtccctt
gggcttaaggatggggacgaggagcacccggcacgcatgggatggattgtgggtattaac
gagcgcaccaagcagaggggagactttcctgggacttatgttcagtatgtgggaactgtg
aagatgtttgtgatgcccaaccagcccaggcagcagagacccctccctgcagtacccagg
ccacagcctccgccatcgcagcaagggacatccactttgagggactttttcctgccgttt
tcttccctagaaaacattccccccactttggtgaagttggtagaggctattgagagaaaa
ggtctggagggtgagacgctgtataggacatctggctcctcggctgctggcggtcagaga
ccaagcctgaatcttgatcttcctgagtctgagatgggccagcacgatgtccggggtctc
actgaggccctgctgggattcctgcgggaccttccctctcctgtcatccccgagtccgtc
tatcccagcctgaggagcgccctaaacgagggagcagagctgtctgtcgaggactcgggc
aggcgtctgctgaaggagctggtgcccccagccgtacctgcagcgagcctgcttaccctg
cagtacctgctccgacacctggaccgggtcgcccagagagccgagtgcaatggcctggac
ccggcctccctttcactccttttcacccctctgctgttcagcgctgggtcagaagaagat
catctgttttctgtgcaggtgctggagagactgctggtggccagggcctgggagctggaa
caaatgccaccagccctacctcctaagccttccaaaaccaaagccgtggcatcgtctgtc
atcagtggagatggtggcaagatggctgatgcagagtggtactggggagacatttccaga
gaggaggtgaatgagaagatgagggacactccggatggcacattcttggtcagagacgcc
tcaagcaaggttcaaggcgaatacacattaactctcaggaaaggaggaaacaacaagctg
atcaagatcttccaccgaggcggcaagtatgggttctctgagccgttgaccttttcttct
gtggtggagctcatcctgcattatcaccacgagtcgctggcccaatacaaccccaagctg
gactcacggctactgtatcctgtgtccaaatttcagcaggatcagatggtgaaagaggac
aacgtggaagcagtgggggagcagctgaaggtgtatcacgagcagtaccaggaaaagagc
caggcatacgacatcctgtatgaggagtacactcgcacctcccaggagctacagatgaaa
cgcacggccatcgaggccttcaacgagacaatcaagattttcgaggagcagtgccaaacc
caggagcgctacagcaaggagtacatggagaagttccagcgggagggcaacagcaaagag
atggagagaatccaaagtaattcaaataagctgaagtctcgggtgactgagatccatgac
agcaagaggaggctggagcaggacctgaaggaggaggcggcggacaaccgagagatcgac
aagaagatgaacagcctgaagccggacctcatgcagctgaggaagatccgggaccagtac
ctggtgtggctcaatcagaagggaacccgacaaagaaagattaacgagtggctggggatc
aagaacgacattgaagacgtctattctctggtggacgaggaggaagatctgccgcaccac
gacgagcgtacctggtacgtgggcaacattaaacgtggacaagccgaggagctgttgagg
ggcaaggacgatggcaccttcctgatccgagacagccaatcccagaagggctcctacgct
tgctctgtggttgtggacagggacataaagcactgtgtgatcttcaagacctccacgggc
tacgggtttgcagagccttacaacttgtacgcctccctcagggagctggtgctccattac
agacacacctccctggtccagcacaacgactcactgaacgttaccctagcgtttcctgtc
ctgacccagcagcagaccagatga

KEGG   Esox lucius (northern pike): 105026926
Entry
105026926         CDS       T04894                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105026926 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105026926 (pik3cd)
   04370 VEGF signaling pathway
    105026926 (pik3cd)
   04068 FoxO signaling pathway
    105026926 (pik3cd)
   04070 Phosphatidylinositol signaling system
    105026926 (pik3cd)
   04150 mTOR signaling pathway
    105026926 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105026926 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    105026926 (pik3cd)
   04218 Cellular senescence
    105026926 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105026926 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105026926 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105026926 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    105026926 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105026926 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    105026926 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105026926 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105026926 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105026926 (pik3cd)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105026926 (pik3cd)
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105026926 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 105026926
NCBI-ProteinID: XP_010897036
LinkDB
AA seq 1045 aa
MPPVEYGMLGEWEKEGDLEIMMDFLLPTGIFLKFSVSHNDTIGAIKKMVWSNASNEPLYG
ALSDMDAYVFTCINSTAEREELEDETRRLCDVRPFMPVLRLVAREGDRVEKLTNTQISLL
IGKGLHEFDSQKNHEVNEFRAKMRSFCEERALERQQLPWYQWMEYSFPCELEPCVLLAEP
GGIKTKCKKIFVNVKFEASDESFMLQHEPQDLPVTLMRSALKKKATVFRSVHQEKPEDYT
LQVNGRWEFIYGKYPLCQFKYIFSCMRGGQTPHLTMVHHTTIVKYQEEQGRLASQVSRCR
SLSKPPPLPLKKQNTSSLWSIEEPFNIHLIQGNRVNADEGMKLMVQAGLFHGSEMLCKVV
TSGEVNVCSEPLWDQKLVFDINVSDLPRMSRLCFALYAVIEKNKKPRSTKKKNKKADCPL
AWVNTMVFDYKDQLKTGEFLLSTWPSVPDDKGDLLNPMGTVEKNPNIDSAPGLLIRFPNI
RPYPLYYPPLEKMSELERKGEKLKATKEEHMKLMEIVDNKNYTEFFEDDKELLWNLRGVV
RQRYPESLSKLLLITKWNKREDVAQMVDLLHKWPELPALHALELLDYCFPDPRVRSFTIR
CLRKLSDEELLQYLLQLVQVLKYESYLDCDLTTFLLERALANKRIGHFLFWHLRSEMHVS
SVSLRFGLILEAYCRGNICHIKSLWKQNEALNKMKAVNDFVKSGWQKTSRQQMTDDMKLC
IKQEAYIWALSNLLSPLNPSIILSEICADRCKFMDSKMKPLWLMYKNKCVQGEAAGIIFK
NGDDLRQDMLTLQMIQLMENLWKKEGLDLRMIPYGCLSTGNKTGLIEVVKNSETIANIQR
NNSNSAATAAFNKDALLNWLKSKNPEDKLDNAIEEFTLSCAGYCVATYVLGIGDRHNDNI
MIKETGQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQQGRTNNSEKFERFRAY
CEQAYKILCRNGTLFVNLFAMMKAAGLPELSSFKDIQYLKDSLALGKSEEEALKNFKVKF
NEALRESWKTKVNWMMHSLAKDSRL
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgcccccagtggagtatgggatgctgggtgagtgggagaaggagggtgacctggagatc
atgatggacttcttgctgcccactgggatcttcctgaagttctctgtatctcacaacgac
accattggggccatcaagaaaatggtgtggagtaatgccagcaatgaacctctctatgga
gcactgagtgacatggacgcttatgtgttcacctgcatcaactcgacagcagaacgtgag
gagctggaggatgagacccggcgtctttgtgacgtcaggcctttcatgccggtccttagg
ctggtggcccgggagggtgaccgcgtggagaaactcaccaacacccagattagccttctg
attggcaaaggtctgcatgaatttgactcccagaagaaccacgaggtgaatgagttccgg
gccaagatgcgttccttctgtgaagaaagagccctggaacgccaacaactgccatggtac
cagtggatggagtacagcttcccatgtgaattagagccatgtgttttactggcagagcct
ggaggcattaagacaaaatgcaagaagatttttgtcaatgtaaagtttgaggccagtgat
gaaagcttcatgctacagcatgaaccccaggacttgccggtaactctgatgcggagtgcc
cttaagaagaaggccactgtgtttcgttccgtgcatcaggagaaacctgaggactacaca
ttacaagtcaacgggagatgggagtttatctatgggaaataccctctgtgccagttcaaa
tatatcttctcctgtatgagaggaggtcaaaccccacacctgaccatggttcatcatacc
accattgttaaatatcaggaggagcagggcagactggccagccaggtgtcgaggtgtcgc
tccttgtccaagcctcctcctctacccctgaaaaagcagaacacttcctctttgtggtcc
atcgaagagcctttcaacattcacctgatacaaggcaaccgagtcaatgcagatgaagga
atgaagctgatggtccaggcgggtctgttccatggtagtgagatgctgtgtaaggtggtg
accagcggggaggtcaacgtgtgctcagagcccctgtgggaccagaagttggtgttcgac
atcaacgtgagcgacctgcctcgtatgagccgcctgtgctttgctctctatgccgtcatc
gagaagaacaagaagcctcgctcaactaaaaagaagaacaagaaagctgactgtccacta
gcctgggttaacactatggtgtttgactataaggatcagctgaagactggggagttctta
ctttccacctggccttcagtccctgatgataaaggcgacctcttgaatccaatgggtacc
gtggagaaaaaccccaacattgatagtgcaccaggactcctcattcgctttcccaatatc
agaccttaccccctctactaccccccactggagaagatgagtgaactagaaagaaaagga
gagaagttgaaagccactaaagaggagcacatgaagctaatggaaatagtggacaataaa
aactacacagagttctttgaggacgataaagagcttctatggaatctacgcggtgtggtg
cgacagcgctacccagagagtctgtcaaaacttctcctcatcacaaaatggaataagcgt
gaggatgtagcgcagatggtggatttactgcacaaatggccagaactccctgccctccat
gccttggagctcttggactactgtttcccagacccaagggtccgctctttcaccattaga
tgcctgaggaagctgagtgatgaggagcttctgcagtacttgcttcagttggttcaggtt
ctcaagtatgagtcttatctggactgtgacctaactactttcttactagagagagccctt
gccaacaagaggattggccacttcctcttctggcatctcagatcagaaatgcacgtatcc
tcagtcagtctgcgcttcggcctgattttagaggcgtactgcaggggcaacatctgtcac
atcaagagcttatggaaacagaatgaggctctgaacaagatgaaggctgtgaatgatttt
gtaaagtcaggatggcagaagacatcacgccagcagatgacagatgacatgaagttgtgc
atcaaacaggaggcctacatctgggccctctcaaacctgctctccccgctaaacccaagc
atcattctctctgaaatctgtgcggacagatgcaaattcatggactccaagatgaagccc
ctgtggctcatgtacaagaacaagtgtgtccaaggggaggctgcagggataatcttcaag
aatggagatgatctccgacaagacatgttgaccctacaaatgatccagctgatggaaaac
ctttggaagaaagagggtctggacctcaggatgatcccctatggctgcctctccaccgga
aacaagacgggcctaatcgaggtggtgaagaattcagagaccattgcaaacatccagcgc
aacaacagtaacagtgctgccactgctgccttcaacaaagatgccctgctcaactggctt
aaatccaagaacccagaagataaacttgataatgctattgaagaattcactttatcctgt
gctggctactgtgtagccacttatgtgttgggtatcggagatcgccacaacgacaatatc
atgatcaaggagactgggcagctgttccacattgactttgggcactttctggggaacttc
aagagcaaatttgggatcaacagggaacgtgtgccttttattctgacttacgactttgtc
cacgtcatccaacaagggaggaccaacaacagtgagaagtttgaaaggtttagggcgtac
tgtgagcaggcctacaagattttatgtcgcaacgggactctgtttgtaaacctgtttgca
atgatgaaagcagccggattgcctgagctaagctcctttaaggatatccagtacttaaag
gactcattagctttggggaaatcagaggaagaagcactgaagaatttcaaagtgaagttt
aacgaagctctgagggagagctggaagaccaaagtgaactggatgatgcactctctagcc
aaagatagcagactttaa

KEGG   Esox lucius (northern pike): 105028918
Entry
105028918         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105028918
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105028918
   04370 VEGF signaling pathway
    105028918
   04068 FoxO signaling pathway
    105028918
   04070 Phosphatidylinositol signaling system
    105028918
   04150 mTOR signaling pathway
    105028918
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105028918
  09143 Cell growth and death
   04210 Apoptosis
    105028918
   04218 Cellular senescence
    105028918
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105028918
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105028918
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105028918
   04625 C-type lectin receptor signaling pathway
    105028918
  09152 Endocrine system
   04910 Insulin signaling pathway
    105028918
   04914 Progesterone-mediated oocyte maturation
    105028918
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105028918
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105028918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105028918
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105028918
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105028918
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 105028918
NCBI-ProteinID: XP_010900282
UniProt: A0A3P9ANT2
LinkDB
AA seq 1068 aa
MPPRPSSGELWGMHLMPPTIQVDCLLPNGMILTLECTREATLISVKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDSEVQDFRRNILNVCKESVDLRDTNGPISRALYVYPPNVESSVELPKH
IFNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSHEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPVD
TFAMPSYARRISTATPYMNGETAAKSLWTINGTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SNPVKFPDMPAIEEHANWNISRELGFNYSHSGLSNRVARDNPLTDSDNEQLRLVCNRDPL
SEITEQEKDFLWRHRHYCVSIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIRDFAVKCLEKYLTDDRLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQSNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNRGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccaggccgtcttctggggaactatggggcatgcatttgatgcctccgacaatc
caggtggactgccttctccccaatggcatgattctgacattggagtgcacgcgcgaggcc
acactcatctcggtcaaacacgaactattcaaggaggccaggaagtatccactccatcac
ctcttacaagaggagacgtcctacatatttgtcagcgttacccaggaggctgaaagagag
gaattctacgatgagacgaggagactatgtgacctcagactttttcaggcattcttgaaa
gtaatcgagccagtaggcaaccgagaggagaaaattctcaaccgagaaattggttttgcc
ataggaatgcctatatgtgaatttgacctggtcaaggactctgaggtgcaggactttaga
aggaacattttgaatgtctgcaaagagtctgtagacctcagagacactaacggacccatc
agtagagccttgtatgtttaccctcccaatgtagagtcgtcagtagaacttcccaagcac
atctttaataaacttgacaaaggacaaatcatagtggtaatctgggtcattgtgtcaccc
agcaacgacaagcaaaagtacacgctgaagatcaaccatgactgcgtgccagagcacgtg
atcgccgaggcaatccgcaagaagacgcgcagcatgctgctgtcccacgagcagctcaag
atgtgcgtgcaggagtaccagggcaagtacatcctgaaggtgtgtggctgcgacgagtac
ctgctggaaaagtaccccctgagccagtataagtatgtccggagctgcatcatgctgggt
cgaatgcccaacctcatgctgatggccaaggacagcctctactcccagctgcccgtcgac
accttcgccatgccgtcgtacgcgaggcgcatctccacggcgacgccctacatgaacggc
gagacggccgcaaagtccctgtggaccatcaacggcacactgcggatccgggtcctgtgc
gccacctacgtcaatgtgaacatcagggacattgacaagatctatgtccggactgggatc
taccatggcggtgagcagttgtgcgacaatgtgaatacccagcgcgtgccgtgctcgaat
cccaggtggaacgaatggctgaactacgacatgtacattccggacatcccccgcgccgcc
cgcctctgcctctccatctgctccgtcaaggggagaaagggagctaaagaggagcactgt
ccgctggcctggggcaacatcaacctgttcgactacacccacacgctggtggccgggaag
atggccctcaacctgtggcccgttccccacggcctggaggacctgctcaacgccatcggg
gtcaccggatccaatccaaacaaggaaaccccttgcttggaactggagtttgaccacttc
agcaacccggtcaagttccccgacatgcctgccatcgaggagcacgccaactggaacata
tcccgggaactgggcttcaactacagccacagcggtttgagcaacagagtggcaagggac
aaccccctgacagacagtgacaatgaacagttgcgtctggtgtgtaacagagacccactg
tcagaaatcactgagcaggagaaggacttcctttggaggcacagacattattgcgtcagt
atccctgagatactgccaaagattctcctggcagtgaaatggaactccagagatgaggtt
gcacagatgtattgccttctaaaggactggccagccattaaaccagagcaagccatggag
ttgctggactgcaacttccctgaccccatgatccgagactttgccgtaaagtgccttgag
aaatacctaacggacgaccgactctctcagtatctcattcagctggtccaggttctaaag
tacgagcagtaccttgacaacccactggcccgcttcctgctgaagaaagctctgactaat
cagcggataggacatttcttcttttggcatctcaagtctgagatgcacaacaagacggtg
agccagcggttcggcctgctgctggagtcctactgccgggcctgtggcatgtacctgaag
cacctgagcagacaggtggaggccatggagaaactcatcaacctcactgacctccttaag
caggagaagaaggacgaggcccagaaggtgcagatgaagttcctggtggagcagatgaag
aggccagactacatggatgccctgcagagcttcacctccccgctcaacccggcgcaccag
cttggaaacctccggctggaggagtgccggatgatgtcatcagccaagcggcctctgtgg
ctgaactgggagaaccctgacatgatgtcagagctgctcttccagagcaacgaaatcatc
ttcaaaaatggagacgatctcaggcaggacatgctgactctgcagatcattaggataatg
gagaacatctggcagaaccaggggcttgatctcaggatgctgccgtacggctgcctgtcc
atcggtgactgcgtgggcctgatcgaggtggtgaggaactcccacaccatcatgcagatc
cagtgcaagggcggtctcaagggggcgctgcagttcaacagccacacgctgcaccagtgg
ctgaaggacaagaaccgcggggagatgtatgaccaggccattgacctgttcacacggtcg
tgtgcgggctactgcgtggccaccttcatcctggggatcggcgataggcacaacagcaac
atcatggtcaaagacgacggacagctgttccacatagactttggccatttcctggatcac
aagaagaagaaatttggctacaagagagaacgcgtcccttttgttttgacacaggacttc
ttaatcgtcataagcaaaggaacccaggagtgcaccaaaaccagggagttcgagaggttc
caggagatgtgctacaaggcctacctcgccatccggcagcacgccaacctcttcatcaac
ctgttctccatgatgctgggctccgggatgcccgagctgcagtccttcgacgacatcgcc
tacatccgcaagaccctggcgctggacaagacggagcaggaggccctggactacttcatg
aagcagatgaacgacgcccaccacggcggctggaccaccaagatggactggatcttccac
accatccgccagcacgccatgaactga

KEGG   Esox lucius (northern pike): 105029118
Entry
105029118         CDS       T04894                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X3
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105029118 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105029118 (pik3cb)
   04370 VEGF signaling pathway
    105029118 (pik3cb)
   04068 FoxO signaling pathway
    105029118 (pik3cb)
   04070 Phosphatidylinositol signaling system
    105029118 (pik3cb)
   04150 mTOR signaling pathway
    105029118 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105029118 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    105029118 (pik3cb)
   04218 Cellular senescence
    105029118 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105029118 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105029118 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105029118 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    105029118 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105029118 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    105029118 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105029118 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105029118 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105029118 (pik3cb)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     105029118 (pik3cb)
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    105029118 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd RWD DUF4135
Other DBs
NCBI-GeneID: 105029118
NCBI-ProteinID: XP_012991598
LinkDB
AA seq 934 aa
MFRISEEKMQRVQLMNWSEWLQACFCPQLEPVVGAAAGTDGVNDKQAETSLKVTIHFDQS
QDTASLKVCPSTTPSELMEQALRKWLTTHGPEEEGRQAQQYILRVSDKLEFLCGDHPLIQ
YKHIKACLQSKECPHLTLVQISSVKDMFEKEISAIGAVVNRKSSNPPLPLPPKRRGPSQV
NTCVWEVPLPFKIFLIKGSKVNAEETAKVQVRAGLFHGTELLCKPAVSSESSGRSEHVWN
RMLEFDIQVSDLPRMARLCFAVYAIMDKVKKRKSTNNSHINKYQTIRKAGKVHYPIAWVN
TMVFDYKGQLKTGDITLHSWSSFPDELEEMLNPIGTIQTNPYTENATALHIQFPDYIAHP
IVFPPFDKILEKAAEIARSSDCSPMGRGGKKFHIELKEIMERDPLSQLCENEKDLIWTLR
YDCMENFPQSLPKLLLSVKWSKHEDMAQLQALLQIWPKLSPRDALELLDFNYPDQYVREY
AVGCLKDMSDEELSQYLLQLVQVLRYEPYYDCALTRFLLDRGQGNRNIGHFLFWHLRSEM
HMPAVSVQFSLILEAYCRGSIPHIEVLKKQVEALSKLKSVNELIKLGTIKNVRSKTKEAM
LTKEAMMTCLRQSGYTETLSDLHSPLNPSVLLSGINVEKCRYMDSKMKPLWIVYNNKLLG
GDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEANLDLRIVPYGCLATGDRSGLIEVVSS
ADTIANIQLTSSNVAAAAAFNKDALLNWLKEKNSGDALEKAIEEFTLSCAGYCVATYVLG
IGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILTHDFIHVIQQGKTGNT
EKFGSFRNYCEQAYLILRRNGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKTDDE
ALKQFRQKFDEALRESWTTKVNWMAHNVVKDNRS
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgttccgcatcagcgaggagaagatgcagcgggtacagctgatgaactggagtgagtgg
ctgcaggcctgcttctgcccgcagctggagccagtggtgggagccgccgccggaacggat
ggcgtcaacgacaagcaggccgagacgagcctcaaagtcaccatacacttcgaccagtcc
caggacacagccagtctgaaggtatgccccagcactactcccagtgaactaatggaacag
gcgttaagaaaatggctgaccacacatggccctgaagaggagggacgtcaggcccaacag
tacattcttagggttagcgacaagctggagttcctctgtggagaccaccccctcatccag
tacaagcatatcaaggcatgtctccagtctaaagagtgtccacacttgactctggtccag
atcagctctgtcaaagacatgtttgagaaggagatctcagccatcggagctgtggtcaac
cgcaagagctccaaccctcctttacccctgccccccaagagaagaggtccctcgcaggtc
aacacctgtgtctgggaagtgcccctcccgttcaagatcttcctgatcaaaggcagcaag
gtgaacgcagaggagacggccaaggtccaggtccgggcgggcttgttccatggcaccgag
ctgctgtgcaagccggcggtaagcagcgagagcagcggacgctcggagcatgtgtggaac
cgcatgctggagttcgacatccaggtgagcgacctgccccgcatggcccgcctctgcttt
gccgtctacgccatcatggacaaggtcaagaagcggaagtccaccaacaactcccacatc
aacaagtaccagaccatccgcaaggccggcaaagtgcactaccccattgcctgggtgaac
accatggtgtttgactataaaggacagctgaagactggagatatcaccctgcacagctgg
tcttccttccctgatgaacttgaagagatgctgaaccccataggaaccatccagaccaac
ccgtacacagagaacgctacagccctccacatccaattccccgactacatcgctcacccc
attgtgttcccccccttcgacaagattttggagaaagctgcagagatcgccaggtcaagc
gactgctcgcccatgggccgaggaggtaagaagttccacattgagctgaaggagatcatg
gagagggacccgctgtcccagctgtgcgagaatgagaaggacctcatctggacactacgt
tacgactgcatggagaacttcccccagtccctgcccaaactgcttctctctgtcaagtgg
agcaaacacgaggatatggcccagctccaggccttgctacagatctggcccaagctgagt
cctcgagatgctctggagctgctggactttaactatccagaccagtacgtcagagagtat
gccgtgggctgcctgaaagatatgagtgacgaggagttgtctcagtacctactccagctg
gtccaggtgttgcgctacgaaccctactacgactgtgccctcacacgcttcctactggac
agaggccagggcaatcgcaacataggacatttcctcttctggcatctccggtctgagatg
catatgccagctgtctctgtccagttctctctcatcttggaggcctactgtcgcggcagc
attcctcacattgaggtcctaaagaagcaggtggaggctctgagcaagctgaagtcggtg
aacgagctgattaaactgggtaccataaagaacgtccgcagtaagaccaaggaggccatg
ctcacgaaagaggccatgatgacatgtctgaggcagagtggctacacggagaccctctcc
gacctgcactcccccctcaaccccagcgtcctgctctctggaatcaatgtggagaagtgt
cggtacatggactctaagatgaaacctctgtggattgtctacaataacaagctgctggga
ggggacaccctgggaatcatcttcaagaatggagatgacctgagacaagacatgttgacg
ctgcagatcttgcgtttgatggaccttttatggaaagaggccaatctggatcttagaatc
gtgccttacggctgcctagcgacgggggaccgctcagggctgattgaggtggtgtcgtcg
gcggataccatcgccaacatccagctcaccagcagcaatgtagcggcagccgcagccttc
aacaaggatgccctactcaactggctcaaagagaagaactctggcgacgctctggagaag
gcgatcgaggagttcaccctgtcctgtgcgggctactgcgtggccacctacgtcctgggt
ataggtgaccgccacagtgacaacatcatggtccgcagcaccggacagctctttcacata
gacttcgggcatatcttggggaacttcaagtccaagtttggcatcaagagagagcgtgtt
cccttcattttgacccacgacttcatccacgtcatccagcaggggaaaacgggcaacact
gagaagtttggaagtttccgtaattactgtgagcaggcctacctgattctgaggcgaaac
gggaaccttttcatcaccctgtttgcccttatgctgactgctggactgcctgaactcacc
tcagtgaaggatatacagtacctaaaggactctctggccctggggaagaccgacgacgag
gcactgaaacagttccggcagaagtttgatgaggcactacgagagagctggaccaccaaa
gtcaactggatggcccacaatgtggtcaaagacaaccgctcctag

KEGG   Esox lucius (northern pike): 109614581
Entry
109614581         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04370  VEGF signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109614581
   04370 VEGF signaling pathway
    109614581
   04068 FoxO signaling pathway
    109614581
   04070 Phosphatidylinositol signaling system
    109614581
   04150 mTOR signaling pathway
    109614581
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109614581
  09143 Cell growth and death
   04210 Apoptosis
    109614581
   04218 Cellular senescence
    109614581
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109614581
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109614581
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109614581
   04625 C-type lectin receptor signaling pathway
    109614581
  09152 Endocrine system
   04910 Insulin signaling pathway
    109614581
   04914 Progesterone-mediated oocyte maturation
    109614581
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109614581
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    109614581
Membrane trafficking [BR:els04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109614581
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Ribosomal_L22e HAUS6_N
Other DBs
NCBI-GeneID: 109614581
NCBI-ProteinID: XP_012988754
LinkDB
AA seq 730 aa
MAVEGFQYRALYVYTKDLEEDIDLQPGDILTVSKASLFSLDFKEGDEEHPELLGWLLGFN
ERTKQRGDFPGTYVQFVGPVRMSPPSSQPRSQRPLPAAPGPEPTASQIAVALPDLTEQFT
PPETAPPALVNLVEAIEKRGLGCKTLYRTPSASDGLARSLSEEVELALGGDMGILSECVL
RYLRGLPSPVIPSGVYPDLQAALRAAADRAVTVEASGDGSLSLILEGAAGVPLQHNLTLH
YLLTHLGRVAQCSHLNGLDPHALGQVFGPLLIRPSSGPGWEEEFPALAVERLLIERTMGD
EVPPPALPAKPLKAKATSPAMTETSILSDSEWYWGEISREEVNEKMKDTPDGTFMVRDAS
SKLEGEYTLTLRKDGNNKLIKVCHRGGRYGFSEPLTFPTVVELINHYRHESLAQYNAKLD
TRLLYPVSKYQQEQLVKEDSIEAVGEQLKVYHEQFQEKSKEYDVLYEEYTRTSQELQMKR
TAIEAFNETIKIFEEQCETQERYSRESIERFRREGNDKEIQKIQSNSERLKSRVTEIHDS
KRKLEQDLKQQATDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGTRQKKINEWLGIK
NEAEDSYSLVVEEDEGSPHHDEATWYVGDVKRTEAEELLRDKRDGTFLIRESQTQKGSYA
CSVVVDGDAKHCVIYKTDRGYGFAEPYNLYGSLRDLVLHYKHESLVQHNDQLNVTLAYPV
LTQTQMQHPR
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggcggttgagggtttccaataccgtgccctctatgtctacaccaaggatttggaggag
gacattgacctgcagcccggagacatcctgaccgtcagcaaagcctccctgttctctctg
gatttcaaagagggggatgaagagcatccggagctcctgggctggctgctgggcttcaac
gagcgtaccaagcagaggggggacttcccggggacatatgtccagttcgtgggccctgtg
aggatgtcaccgccgtccagccagcctcgctcgcaaagacccctcccagcagccccaggg
cctgagcctacagcgtcacagatagctgtcgctcttccagatttgaccgagcagttcacc
ccgccagaaactgccccccctgccctggtgaacctggtggaggccatcgaaaagagaggt
ctgggctgcaagaccctttacaggacaccatctgcctcagatggcttagctcggagcttg
agtgaagaggtggagttggcgctgggcggtgacatgggcatcctgtcggagtgtgtgctc
cgctacctgcgggggctgccgtcccccgtcatcccctccggtgtttacccagacctgcag
gctgctctgagggctgcagcagatcgggctgtgactgtggaggcaagcggagacgggagt
ctgagtctgatcctggagggggccgctggcgtgccactgcaacacaacctcaccctgcac
tacctgctcactcacctgggcagggtggcccagtgttcccatctcaacggcctggaccct
catgccctgggccaggtctttggcccgctactgatccggcccagctctggacccgggtgg
gaggaggagtttcctgcactggcagtggaaaggctgctgattgagaggaccatgggagat
gaagttccgcctccagctctaccggccaagccgttgaaggccaaagccacatctccagcc
atgactgagacaagcatactgagtgattctgagtggtactggggggagatctccagggag
gaggtgaatgagaagatgaaagacacccccgatggcacgttcatggtccgtgacgcgtcc
agcaaactggaaggagagtacacactgaccctcagaaaagacggaaacaataagctgatc
aaggtctgccaccggggaggtcgctacggcttctctgagcctctcaccttccccacggtg
gtggagctcatcaaccactaccgacatgagtccctggcccagtacaatgccaaactggac
actcggctcctttaccccgtctccaaataccagcaggagcagctggtgaaggaggacagc
attgaggcggtgggggagcagctgaaggtgtaccacgagcagtttcaggagaagagcaag
gagtatgacgtgctgtatgaggagtacactcgcacctcacaggagctccagatgaagcgc
acagccattgaggccttcaatgagaccatcaagatcttcgaggagcagtgtgagacccag
gagcgctatagcagggaatccattgagaggttcagacgcgaaggcaacgacaaggagatc
cagaagatccaaagtaactcggagcgcctgaagtctcgggttactgagatccacgacagc
aagaggaagctggaacaagacctgaagcagcaggccaccgacaaccgagagatcgacaag
aggatgaacagcctgaagccggacctcatgcagctcaggaagatcagggaccagtacctt
gtctggttgacacaaaaggggacgaggcagaagaagatcaatgagtggctgggcattaag
aatgaggcagaggactcctactcactggtggtggaggaggacgagggctcgccccaccat
gacgaggccacctggtacgtgggcgacgtcaagcgcaccgaggcggaggagctgctgagg
gacaagcgcgacggcaccttcctcatccgagagagccagacgcagaagggctcctacgcc
tgctctgtggttgtggacggtgatgccaagcactgcgtcatctacaagacggacaggggc
tatggctttgcggagccctacaacctctatggctccctgagggacctggttctccactac
aagcacgagtccctggtccaacacaatgaccagctgaatgtaaccctggcctacccggtc
ctaacccagacccaaatgcagcatcccagatga

DBGET integrated database retrieval system