KEGG   Empidonax traillii (willow flycatcher): 114055714
Entry
114055714         CDS       T05887                                 

Definition
(RefSeq) caspase-8-like isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl04620  Toll-like receptor signaling pathway
etl04621  NOD-like receptor signaling pathway
etl04622  RIG-I-like receptor signaling pathway
etl04625  C-type lectin receptor signaling pathway
etl05132  Salmonella infection
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114055714
   04217 Necroptosis
    114055714
   04115 p53 signaling pathway
    114055714
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114055714
   04621 NOD-like receptor signaling pathway
    114055714
   04622 RIG-I-like receptor signaling pathway
    114055714
   04625 C-type lectin receptor signaling pathway
    114055714
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114055714
  09172 Infectious disease: viral
   05164 Influenza A
    114055714
   05168 Herpes simplex virus 1 infection
    114055714
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114055714
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     114055714
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C14: caspase family
   114055714
SSDB
Motif
Pfam: Peptidase_C14 DED HTH_Crp_2
Other DBs
NCBI-GeneID: 114055714
NCBI-ProteinID: XP_027735920
LinkDB
Position
Unknown
AA seq 481 aa
MELPRWQLLAVSEELDEAELAALKFLSREHVPRRRLEAARSAHDLFEALQERGALEAGNL
AFLRELLYRIGRIDLLAAHLGSSREQVERELQVPRAGGARVSPYRYLLFQLSEDITKDEL
MSFKLLLDGTLPKSKLTPETTMLDIFAEMEKKGLLGKDNLSELKSLCEKINISLWDRIED
QLNLFGQEEMLITEEERGSTGGPEGCLALSVAREFPGSCNISSQLEAYRMTSRPCGVCLI
LNNHSFAKAREAVLEHKYLRDRNGTDVDAAALRNVFSKLHFRIEEYKDLTADEIRRTVNI
FRCEDHEDKDCFVCCVLSHGKKGIIYGVDGQEVAIRELTTSFTVQNCPSLAGKPKVFFIQ
ACQGNAFHKGVTIEADSAEQDASAERDVRFQLDCIPAEADFLLGMATLQDYVSYRSPKEG
TWYIQALCQHLESRCPRGESVVSILTAVNREVSRKTGERNAEKQMPQPIFTLKKKLIFPV
I
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggagctgccccggtggcagctgctggcggtcagcgaggagctggacgaggccgagctg
gcggcgctgaagttcctgagccgggagcacgtccccagaaggaggctggaagccgcccgg
agcgcgcacgacttgttcgaagcgctgcaggagaggggcgcgctggaggcggggaacttg
gccttcctcagggagctgctgtaccgcatcggcaggatcgacctcctggctgcccacctg
ggctccagccgggagcaggtggagcgggagctgcaggtccccagagcgggcggggcgcgg
gtgtcgccctacagatacttgctctttcagctctcggaagacatcaccaaagatgagctg
atgtctttcaaattacttttggatggaacattaccaaaaagcaagctaacccctgagacc
acaatgctcgacattttcgctgagatggagaagaaggggcttctgggaaaagacaaccta
agtgagctgaagagtctctgtgaaaaaattaacatcagcctgtgggacagaattgaagat
caattaaacctatttggtcaagaagagatgctcatcacagaggaagaaaggggcagcaca
ggaggccctgaagggtgtctggcattatctgtggcacgtgaatttcctggcagttgtaat
atctcttcccagcttgaggcttacagaatgaccagccgaccctgtggagtgtgcctcatc
ctgaataatcacagttttgcaaaagctagggaagctgtgctggaacacaaatacctgagg
gaccgcaatgggacagacgtggatgcagctgctctgagaaatgtctttagcaagcttcat
tttaggatagaagaatacaaagacctcactgcagacgaaatccgcaggactgtgaacatc
ttccgctgtgaagaccacgaggacaaggactgttttgtttgctgtgtcctgtctcatggg
aaaaaaggcattatatatggtgttgatgggcaagaggtagcaatccgggagctgaccact
tctttcactgtgcagaactgcccctcacttgctgggaaaccaaaagtcttttttatccag
gcctgccaaggtaacgctttccataaaggcgtgaccattgaagcggattctgcagagcaa
gacgcgtctgcggaaagagatgtgagattccagctcgactgcatccccgcagaggcagat
ttcctcctgggcatggccaccctgcaggattacgtttcctacagaagtccaaaagagggg
acctggtacatacaggcgttgtgccagcacttggaatcccgctgtcctcgaggagagagt
gttgtcagcatcctgacagcagtgaatcgagaagtgagcagaaaaacgggtgagcggaat
gcagagaagcagatgccacagccaattttcacattaaagaaaaagctcatctttcctgtt
atctaa

KEGG   Empidonax traillii (willow flycatcher): 114055715
Entry
114055715         CDS       T05887                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl04620  Toll-like receptor signaling pathway
etl04621  NOD-like receptor signaling pathway
etl04622  RIG-I-like receptor signaling pathway
etl04625  C-type lectin receptor signaling pathway
etl05132  Salmonella infection
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114055715
   04217 Necroptosis
    114055715
   04115 p53 signaling pathway
    114055715
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114055715
   04621 NOD-like receptor signaling pathway
    114055715
   04622 RIG-I-like receptor signaling pathway
    114055715
   04625 C-type lectin receptor signaling pathway
    114055715
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114055715
  09172 Infectious disease: viral
   05164 Influenza A
    114055715
   05168 Herpes simplex virus 1 infection
    114055715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114055715
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     114055715
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C14: caspase family
   114055715
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN
Other DBs
NCBI-GeneID: 114055715
NCBI-ProteinID: XP_027735922
LinkDB
Position
Unknown
AA seq 474 aa
MNTDFHKLLFEMSEALVTDELAALKFLSLDHVPMRKLEAIQEPKAFFEVLQEKDMIEAGN
LAFLRELLYRIGRIDLLVTHLGSSREHMERELQVQGRAKVSAYRQLLYGIAEDLTPEDVK
NVKFLLQKQLPKNKLQDNASMLQVFLEMERNRIIKEDDLTMLKDILKAFRADIKKKIDIY
EEKKKDNYSKEELRYPVSVSVHPGEQGAEGKTTNLAVETYKMKNIPHGYCVILNNHIFNN
PKQNRKGTVKDGEAVKRVFKWLQFETVEHMDLEAKEIFEKVKEYSKRDHRNMDCFVCFIF
SHGEKRKIKGIDDEFVNIKDLVSCFSGSNCPSLAGKPKVFFIQACQGSVGHPAVAVEADF
SGHPETDATPSTSIPDLADILIGMSTVEDYLSFRWAESGSVYIQCLCDKMKLLCPQGIDL
LTILTTVNEEVGGKEFIVSNQMPGGKLEKQMPQIITTLRKQLIFEIPQGQPSKE
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaatacagacttccacaaactcctttttgaaatgtccgaggctttggtcacagatgaa
ctggcagcactgaagttcctcagcctggatcatgttcccatgaggaagctggaagccatt
caggaacccaaggccttcttcgaagtgctgcaggagaaggacatgatcgaggcagggaac
ctggcctttctccgggagctgctctaccgcatcggcaggatcgatctcctggttacccac
ctgggttccagccgggagcacatggagagagagctgcaggtccaaggcagggcaaaggtg
tcagcttacaggcaactgctatatggaattgcagaggacttgactccagaagatgtcaaa
aatgtgaagttcctgctccaaaagcaattacctaagaacaagctccaggataatgcttcg
atgttgcaggtttttctggaaatggaaagaaataggataattaaagaagatgacctgaca
atgctgaaagatatattaaaggcctttagagctgacataaagaaaaaaattgatatctat
gaagaaaaaaagaaagacaattattctaaagaagaactccgctatcctgtgtctgtctct
gtgcatccaggggaacaaggagcagaggggaagacaacaaacctggctgtggaaacatat
aagatgaaaaatatcccccatggttactgtgtgatccttaacaaccacattttcaacaat
ccgaaacagaacagaaaaggaacagtgaaagatggagaggctgtgaagagggtctttaag
tggcttcagtttgagacagttgagcacatggatctggaagcaaaagagatatttgagaaa
gttaaagaatacagcaaaagagatcatagaaacatggactgttttgtttgcttcattttt
tcccacggtgaaaaacgcaagataaaaggcatcgatgatgaatttgtaaatattaaagat
ttagtctcctgcttcagtggatctaattgtccctctcttgctggcaaacccaaggtgttt
ttcatccaggcttgccaaggctctgttggacatccagctgttgcagtagaagcagatttt
tctggacatcctgagacggatgctaccccttcgacttccattcctgatctggctgacatt
ctgattggcatgtctacagtggaagactatttgtccttccgctgggctgagtctggcagt
gtttacattcagtgcctctgtgacaagatgaagttgctttgccctcagggcatcgatctc
ctaaccatcctgacaacagtgaacgaggaagtgggaggaaaagaatttatagtatcgaat
cagatgccaggaggaaaattggagaagcagatgccacagataataacaacactacggaag
caattgatcttcgaaattccacaaggacagccaagtaaagagtag

DBGET integrated database retrieval system