KEGG   Empidonax traillii (willow flycatcher): 114069083
Entry
114069083         CDS       T05887                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04020  Calcium signaling pathway
etl04260  Cardiac muscle contraction
etl04261  Adrenergic signaling in cardiomyocytes
etl04270  Vascular smooth muscle contraction
etl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114069083 (CACNA1C)
   04020 Calcium signaling pathway
    114069083 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114069083 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114069083 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    114069083 (CACNA1C)
   04270 Vascular smooth muscle contraction
    114069083 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:etl04040]
    114069083 (CACNA1C)
Ion channels [BR:etl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114069083 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 114069083
NCBI-ProteinID: XP_027761431
LinkDB
Position
Unknown
AA seq 2175 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRSTPAGLPDEKKGKFA
WFSHSTETHVSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRFCR
RKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLK
MYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYW
NSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITADGE
SPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPM
PDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQILG
NADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGK
LYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTF
EGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGE
QEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTI
CLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGS
IVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFI
KSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCAT
GEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAV
IMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLC
PHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWK
RTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQFA
VLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDGRSAFPQTFTTQRPLHINKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALCRFPSPPTYPSTVSTVEGHGTPLSPTICVQEAPWKLPSKRTHYYETLGRSSSRD
SQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLDYQDDENRQLTPPENSKGEDT
RHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLL
QRSHSPTTFSRLCATPPATPCNRGWPQQTIPTLRLDGAESTEKLNSSFPSVHCGSRFPDS
TGCSSPRRARPVSLTVPSPTAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQE
LADACDMTIEEMENAADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRI
SQEELKDSRIYISSL
NT seq 6528 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattccagaagaaaaccatcaaggttccaactat
gggagtccccgcccggctcatgccaacatgaacgccaatgcagctgcagggcttgcccca
gagcacatcccgactccgggggcagctctgtcctggcaagctgcgatcgatgccgccagg
caagccaagctgatggggagcgctggcaatgcgacgatatccaccgccagctccacgcag
aggaaacggcagcagtacgggaagcagaaaaaacagggtaccaccacagccacgcgtcct
ccccgcgcactgctgtgtttgacactcaaaaatcccatccggagggcctgtatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tacggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggattcgatgttaaagcactgcgggctttccga
gtattacgtccattacggctggtgtctggagttcctagtctccaggtggttttaaattcc
attatcaaggccatggtccctttgttgcatattgccctgctagtgctgtttgtcattatt
atctatgccatcattggactggagttattcatgggaaagatgcataagacctgctaccac
gtgcaagggggactaatagatacgcccgcagaggacgacccgtccccctgtgccccccag
tccgcgcacgggcggcagtgtcagaacggcacggagtgcaaagcaggctgggagggaccg
aaacatggcatcacgaactttgacaactttgcttttgccatgctgacagtgtttcagtgc
atcaccatggagggctggacagatgtgctctactggatgcaggacgctatgggctatgag
ttaccatgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctg
gttcttggtgtgttgagcggggagttttccaaagaaagagagaaggctaaggctcgaggc
gacttccagaagttacgggaaaaacaacagctagaggaggatttgaagggatacttggac
tggataactcaagcagaagatattgatccagaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacagaagcactccagctggtttgcctgatgagaagaaaggaaagtttgct
tggtttagtcactctacagaaacccatgtgagcatgcccaccagtgagaccgagtccgtg
aacacagacaacgtccctggagccgacatggaaggcgagaactgcggcgcgaggctggcg
caccggatctccaaatcaaaatttagtcgctactggcgccgatggaatcgattctgcaga
aggaagtgccgtgctgctgtcaagtccaatgttttctattggttggtgatcttccttgtg
ttccttaacaccctcaccattgcctctgaacactacaaccagccagactggctcacggag
gtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctgctgaag
atgtacagccttggtctccaggcctattttgtgtccctcttcaaccgctttgactgtttc
attgtgtgcggaggaatcctggaaacgatcctggttgagacaaagatcatgtcaccgctg
ggcatttcagttttgagatgtgtccgactcctaagaatatttaaaatcacaagatattgg
aactccctgagtaacctcgtggcttccctcctgaactcagttcgctccattgcctccttg
ttgctgcttctcttcctcttcattatcatcttctcactcctggggatgcagctctttggg
ggcaagtttaactttgatgagatgcagaccaggaggagtacatttgacaacttccctcag
tccctcctcacagtgtttcagatcctgactggggaggactggaattcggtgatgtatgat
gggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttacttcatc
atcctcttcatctgtggaaactatatcctgctgaatgtatttttggccattgctgtggac
aaccttgctgatgctgagagtttaacatctgcacagaaagaggaggaagaagaaaaagaa
aggaaaaagctagcaagaactgctagtcctgaaaagaaacaggagatggaaaaaacagct
gtggaggaagagacaaaggaggagaaaattgagctgaaatcgatcactgctgatggagaa
tccccacctgctaccaagatcaatgtggatgactatcagcccaatgaaaacgaagaaaag
agcccatatcctacaacagaagcaccagcagaggaagatgaggaagaacctgagatgcct
gtcggccctcggcctcgcccaatgtctgagctgcacctcaaggaaaaggctgtgcccatg
cctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccactgccat
cgaatcgttaacgataacattttcaccaacctgatcctatttttcatcttgctcagcagc
atctccctggcagctgaggaccccgtccgacacctctcctttaggaaccaaatcctaggc
aatgcagactatgtcttcactagtatctttacattagaaattattcttaagatgactgcg
tacggggctttcctccataagggctccttctgcagaaactatttcaacatcctagacctg
ctggtggtcagtgtttccctcatctcctttgggatccagtccagtgccattaatgtggtg
aagatcctgcgtgttctgcgagtccttaggccactgagggccatcaacagagccaaagga
cttaagcacgtggtccagtgtgtgtttgtcgccatccgaaccatcggaaacatcgtgatt
gtcaccactttgctgcagttcatgtttgcctgcattggagttcagttgtttaagggcaag
ctgtacagctgcactgatagctccaagcagacagaagcagaatgcagagggtactacatc
acctacaaggatggggaggtcagccagcccatgatacagccccggagctgggagaacagc
aaatttgacttcgacaacgtcttgactgccatgatggccctcttcactgtctcaaccttt
gagggctggccagagttgctgtataggtccattgattcccacatggaagatgtgggaccc
atctataatcacagggttgagatctccatcttctttattatctacatcatcatcattgct
ttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaa
caagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagaatatgccctg
aaagcccggcccctgcggagatacatccctaaaaaccagtaccagtacaaagtctggtat
gtggtcaactccacctattttgaatacctgatgttcgttctgatcctgctgaacaccatc
tgcctggccatgcaacactatggtcagagctgcatgttcaaggaagccatgaacatcctc
aacatgctcttcactggcctcttcaccgttgagatggtcctgaagttaatcgccttcaaa
cccaagcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagc
attgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctcttcctct
atgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgcgtgatg
cgtctcgtgaagctcctgagccgaggggagggcatccggactctgctttggaccttcatc
aaatccttccaggctctcccctacgtggctcttttaatagtgatgttgttcttcatctac
gctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgataccacagaaatcaac
cgcaacaacaacttccagaccttcccccaggcagtgctgctgcttttcaggtgtgcaact
ggtgaggcctggcaggaaatcatgctggcatgtctcccggacaagaagtgcgacccggag
tcggagccggccaactccaccgaagccgatcactcctgtggcagcagcttcgccgtcttc
tatttcatcagcttctacatgctctgtgccttcctgatcatcaatctttttgtagctgtc
ataatggataacttcgattacctgacacgagactggtccattttaggaccacaccacctg
gatgagtttaaaaggatctgggcagagtatgaccctgaagctaagggacggatcaaacac
ctggacgtggtgacgctgctccggcggattcagcccccactgggctttgggaagctctgc
cctcaccgggtcgcttgcaaacgccttgtctccatgaacatgccactgaacagtgatggg
actgtcatgttcaatgccactctctttgctttggtcagaacagcactgaggatcaagaca
gaaggtaacctggagcaagccaacgaagagctgagagcaataattaagaaaatctggaag
cgcaccagcatgaagctgctggaccaggtggtgcctcccgcaggtgacgacgaggtgact
gtcgggaagttctacgccactttcctgattcaggagtatttccggaagttcaagaaacgt
aaagagcaggggctggtgggaaagccctcccagcgcaacgcactctccttacagtttgct
gttttgcaggctggtctgcgcacactccacgacatcgggccagagatccggcgagcaatt
tctggagacctgactgctgaagaagagttagataaggccatgaaagaagctgtctctgct
gcctctgaagatgatatcttccggagagctggaggcttgtttggaaaccatgtcagctat
taccaaagtgatggcaggagcgcatttccccagacatttaccactcagcgacctctacac
atcaataagtctggcaacaaccacggagataccgagtctccatctcacgagaagctggtg
gactccaccttcactcccagcagctactcatcttcaggctccaatgccaacatcaacaat
gcgaacaacactgccctgtgccgcttccccagcccacccacctaccccagcactgtcagc
acagtggaaggccatgggacccccttatcacccacgatatgtgtgcaggaggctccttgg
aaactaccatccaaaaggacacattactacgaaacactgggacgctccagttccagagac
agccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaat
ttgaatgaagacattgagtactgtagtgaaccaagtctgctctctaccgaaatgcttgac
taccaagatgatgaaaacagacaactcactccaccagaaaacagcaaaggagaggacacc
cggcactctccgaagaaagggtttctgtgctcctcagcactaggtcgaagggcatctttt
cacttagagtgtttgaaaagacagaagaaccagggcgtggacgtctcgcagaagacggtt
ctgcctttgcatctggtacatcatcaggcattagcggtggccggcctgagtcccctgctc
cagcgaagccattcccccaccacgttctcccgtctgtgtgctacgccccctgccaccccc
tgcaaccgtggctggccgcagcagaccatcccgaccctgcgcctcgatggggcggagtcc
actgagaagctcaacagcagcttcccgtcggtgcactgcggctcccgcttccccgacagc
accggctgcagcagccccaggagagccaggccggtgtccctcactgtccccagcccgacc
gccgggagcagcaggcagttccacggcagcgccagcagcctggtggaagcggtcttgatc
tcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaggag
ctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctcttgccttttgctaactgcagggac
ccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtagaata
agtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system