KEGG   Empidonax traillii (willow flycatcher): 114071520
Entry
114071520         CDS       T05887                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04012  ErbB signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114071520
   04068 FoxO signaling pathway
    114071520
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114071520
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114071520
NCBI-ProteinID: XP_027765158
LinkDB
Position
Unknown
AA seq 132 aa
MSNVPISNGSPTLECMEARQSEYPKPSACRNLFGLVNHQELNRELKKHLQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGRSPDFYFRPPWLQKAVYKSTARQSLDVNRNCQTVVFVG
SQGISEDTHCVA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccctatttctaatgggagccctaccctggagtgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgcaggaatcttttcgggctggtgaatcaccaagag
ttaaacagggagttgaagaagcacctgcaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccactggaaggcaggtacgaatggcaagccgtggag
aagggaaggtcgcccgacttctacttcagacctccctggctacagaaagccgtctacaag
tccaccgcccgccagagtttggatgtaaacaggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagcttaa

DBGET integrated database retrieval system