KEGG   Empidonax traillii (willow flycatcher): 114072483
Entry
114072483         CDS       T05887                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04012  ErbB signaling pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114072483
   04068 FoxO signaling pathway
    114072483
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114072483
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114072483
NCBI-ProteinID: XP_027766174
LinkDB
Position
Unknown
AA seq 198 aa
MSNVHISNGSPTLECMEARQSEYPKPSACRNLFGVVNHQELKRELKKHLQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGRSPDFYFRPPWLQKAVCKSTTRQSLDVNRNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTGQRKRPMTNDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPRKSSPRRHQM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccatatttctaatgggagccctaccctggagtgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgcaggaatcttttcggggtggtgaatcaccaagag
ttaaaaagggagttgaagaagcacctgcaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccactggaaggcaggtacgaatggcaagccgtggag
aagggaaggtcgcccgacttctacttcagacctccctggctacagaaagccgtctgcaag
tccaccacccgccagagtttggatgtaaacaggaattgccaaaccgtagtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgggcagaggaaaagacccatgaccaatgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacgcccaggaaatcaagcccgagaagacatcaaatgtaa

DBGET integrated database retrieval system