KEGG   Felis catus (domestic cat): 493978
Entry
493978            CDS       T02385                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor precursor
  KO
K04357  epidermal growth factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  JAK-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05160  Hepatitis C
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05226  Gastric cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    493978 (EGF)
   04012 ErbB signaling pathway
    493978 (EGF)
   04014 Ras signaling pathway
    493978 (EGF)
   04015 Rap1 signaling pathway
    493978 (EGF)
   04630 JAK-STAT signaling pathway
    493978 (EGF)
   04066 HIF-1 signaling pathway
    493978 (EGF)
   04068 FoxO signaling pathway
    493978 (EGF)
   04020 Calcium signaling pathway
    493978 (EGF)
   04072 Phospholipase D signaling pathway
    493978 (EGF)
   04151 PI3K-Akt signaling pathway
    493978 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493978 (EGF)
   04540 Gap junction
    493978 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493978 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493978 (EGF)
   05231 Choline metabolism in cancer
    493978 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493978 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493978 (EGF)
   05212 Pancreatic cancer
    493978 (EGF)
   05226 Gastric cancer
    493978 (EGF)
   05214 Glioma
    493978 (EGF)
   05218 Melanoma
    493978 (EGF)
   05219 Bladder cancer
    493978 (EGF)
   05215 Prostate cancer
    493978 (EGF)
   05213 Endometrial cancer
    493978 (EGF)
   05224 Breast cancer
    493978 (EGF)
   05223 Non-small cell lung cancer
    493978 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    493978 (EGF)
   05165 Human papillomavirus infection
    493978 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493978 (EGF)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   493978 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 493978
NCBI-ProteinID: NP_001009381
Ensembl: ENSFCAG00000000506
UniProt: Q95ND4
LinkDB
Position
B1
AA seq 1210 aa
MLLFLIILLPVVFKFSFVSLSVLQGWDCSEGSSSGKGNSTCVGPEPFLIFSHGGSIFRID
LDGTNYEQLVADAGVSVIMDFHYYKERLYWVDLERQLLQRVFLNGTRQETVCNIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALKYPANVAIDPVERFIFWSSEVAG
SLHRADLNGVEVKILLETSERITAVSLDVLDKRLFWIQNNRDGSNSYICSCNYDGGSVHF
NKHLTQHSLFAMSLFGDRIFYSTWKKKTIWIANKRKDMVRINLNPSFVPPGGTKVVHPLL
QPKAESDAWAPGQKLCLRKGNCTGSVCEQDSKSHLCTCAEGYTLSPDGKHCEDVNECAFW
NHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNTSKCSHDCVLTSDGPICFC
PEGSVLETDGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCAASGPQP
FLLFANSQDIRHVRFDGTDYGSLLSQQMGMVFALDHDPVENKIYFAHTALKWIERANMDG
SQRERLIEEAVDVPEGLAIDWIDRKFYWTDRGKALIEGSDLNGKHREIIIKEEVSQPRGI
AVHPMAKRLFWTDMGINPRIESSSLQGIGRRVIASSDLVWPSGITIDYLTDKLYWCDAKQ
SVIEMANLDGSKRQRLAQNDVGHPFAIAVFEDHVWFSDWTMPSVIRVNKRTGKNRVRLRG
SMLKPSSLVVVHPLAKPGSDPCLHQNGGCEHICKERFGSAQCLCREGFVKAPDGKMCLAL
NGHQIPPAVGSEADLSNQVTPLDVLSRNRGSEDNSTESQHMLVAEIMVSDNDDCGPIRCG
TWGQCVSEGENATCQCLKGFTGDGKLCSDINECGTSTTVCPPTSSKCINTEGGYVCQCSE
GYRGDGIHCLDIDECQLGIHTCGENATCTNTEGNYTCMCAGTLSEPGQMCPDSTPPSVLM
EDGRYSVRNSYQECPPSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR
HAGQGRQRQVTVVAVCVVALVLLLLLGLWGAHCYRTKKLPSKNLKNPYEESSREVSRPTD
SEAGMASCPQPWFVVIKEHQNLRNGSQSMALKDSEAADVSQFSSRETGSVQLPSRRNEPQ
VYMGAEQGCCIPPSSDKGPGPHGMQWGFHLPSCEAQPIALGVEKSQSLLSANPILQQRAS
DLPHQKKLTQ
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgctgctcttccttatcattctgttgccagtagtttttaaatttagttttgttagtctc
tcagtactgcaaggctgggactgttctgaaggctcttcctcaggaaaggggaattctact
tgtgtgggtcctgaacccttcttaattttctcccatggaggcagtatctttaggattgac
ctggacggaactaattatgagcagttggtggctgatgctggtgtatcagtgatcatggat
tttcattactataaggaaagactctattgggtagatctagaacggcaacttttgcaaaga
gtttttctgaatgggacaaggcaggagacagtatgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagacatgaaaggaaacaattcccgtgttctcttaagcgccttaaaatatcct
gcaaatgtagcaattgatccagtagaaaggtttatattttggtcttcagaggtggctggc
agcctccacagagcagatctcaatggtgtggaagtgaagattctgttagagacgtcagaa
agaataaccgctgtgtcactggatgtgcttgataaacggcttttttggattcagaacaat
agagacggaagcaattcttatatttgttcctgtaattatgatggaggttctgtacatttt
aacaaacaccttacgcagcacagtttgtttgcaatgtccctttttggtgatcgtatcttc
tattcaacatggaaaaagaagacaatttggatagctaacaaacggaaggatatggttaga
atcaacctcaatccatcatttgtaccacctggtggaaccaaagtagtgcatccactttta
cagcccaaggcagagagtgatgcttgggcacctggtcagaaactctgcctgaggaaaggt
aactgcacaggcagcgtgtgtgagcaagactctaagtcccatttgtgcacgtgcgcggag
gggtatactttaagcccagatggaaagcactgtgaagatgtcaatgaatgtgccttttgg
aatcatggctgtactcttgggtgtgaaaacattcctggatcttattattgcacatgccct
gtaggatttattctgcttcctgatgggaaacggtgtcatcaattaatttcctgtccaagc
aatacatctaaatgtagccatgactgtgttctgacatcagatggtcccatatgtttctgt
cctgaaggctcagtgcttgagacagatggaaaaacatgcagtggctgttcatcacccgat
aatggtggatgtagccaactctgcctccctcttagcccagtatcctgggaatgtggttgc
tttcctgggtatgacctacaactggacaaaaaaagttgtgcagcatcaggaccacagcca
tttttgctgtttgccaattctcaagatattcgacatgtgcgttttgatggaacagattat
ggatccctgctcagccagcaaatgggaatggtttttgcccttgatcacgaccctgtggaa
aataagatatattttgcccatacagccctgaagtggatagagagagctaatatggatggt
tctcagcgagaaaggcttattgaggaagcagtagatgtgccagaaggtcttgccatagac
tggattgaccgtaaattctactggacagacagagggaaagctctcattgaagggagtgat
ttaaatggaaagcatcgtgaaataatcatcaaggaggaggtctctcagccacgaggaatt
gctgtccatccaatggccaagcgattattctggactgatatggggattaatccacgaatt
gaaagttcttcccttcaaggcattggccgacgggttatagctagttctgatctggtctgg
cccagtggaataacgattgattacttaactgacaaattgtattggtgtgatgccaagcag
tctgtgatcgaaatggccaatctggatggttcaaaacgccaaagacttgcccagaacgat
gtaggtcacccttttgctatagctgtgtttgaggatcacgtgtggttctctgattggact
atgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgtctccgaggc
agcatgctgaagccttcatcactggttgtagttcatccattggcaaaaccaggatcagat
ccctgcttacaccaaaatggaggctgtgaacatatttgcaaagagaggtttggatctgct
cagtgtttgtgtcgtgaaggttttgtgaaagccccagatgggaaaatgtgtctggccctc
aatggccatcagataccaccggcagtaggtagtgaagcagatctaagtaaccaagtaacg
ccactggatgtcttatccaggaatagaggatctgaagataacagtacagaatctcagcat
atgctagtggctgagatcatggtgtcagataatgacgactgtggtcctataagatgtggt
acatggggtcagtgtgtttcagaaggagaaaatgccacatgtcagtgtttgaaaggattt
actggcgatggaaaactatgttctgatataaatgagtgtgggacaagcaccaccgtttgc
cctcccacctcctccaagtgcatcaacactgaaggcggctacgtttgccagtgctcagaa
ggctaccggggagatgggattcactgtcttgatattgatgagtgccagttgggcatacac
acctgtggggaaaatgccacctgtacaaatacggagggaaactacacctgcatgtgtgcc
ggcaccctgtctgaacctggacagatgtgtcctgactctactcctccttctgttctcatg
gaggatggccgctattctgtgagaaacagttaccaggaatgccccccatcctatgacggg
tactgcctctataacggtgtgtgtatgtatattgaagcagtggacagatacgcatgcaac
tgtgtttttggctatgttggggagcgatgtcagcaccgggacttgaaatgggaactgcgc
cacgctggccaagggagacagcggcaagtcactgtggtggccgtctgcgtggtggcgctc
gtcttgctgctgctgctggggctgtggggggcgcactgctacagaactaagaagctacca
tcaaaaaatttgaagaatccttatgaagagtcgagcagagaagttagtaggcctacagac
agcgaggccgggatggcctcttgtccccaaccttggtttgtggttataaaggaacaccaa
aatctcaggaatggaagtcaatctatggccctcaaggacagtgaggcagcagatgttagc
cagttttcctctcgggagacagggtcagtgcaactgccatcacggagaaatgaaccccag
gtgtacatgggcgcagagcaaggctgctgcattccaccatccagtgataaaggccctggt
ccccacggaatgcagtggggttttcatctcccttcctgtgaggcacagcccattgctctg
ggggttgagaagtcacaatctctcttgtcagcaaaccccatactgcaacaaagggcctca
gatctaccacaccaaaagaagctgactcagtga

DBGET integrated database retrieval system