KEGG   Falco cherrug (Saker falcon): 102059582
Entry
102059582         CDS       T02911                                 

Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04060  Cytokine-cytokine receptor interaction
fch04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102059582
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102059582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fch04052]
    102059582
   00536 Glycosaminoglycan binding proteins [BR:fch00536]
    102059582
Cytokines and growth factors [BR:fch04052]
 Cytokines
  Interleukins
   102059582
Glycosaminoglycan binding proteins [BR:fch00536]
 Heparan sulfate / Haparin
  Cytokines
   102059582
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102059582
NCBI-ProteinID: XP_005440793
LinkDB
Position
Unknown
AA seq 135 aa
MIIPVPVLLILLALPACQGHVAARLQTSIFLKESIRLLNELLKTKVSCDNINMTNIFSGD
KEYDDMETLCKATTVAWEGRSCHRHLEGIYLNLLSLVQRKSPAHKAPCPVAAGNTTSLND
FLVDLRRVLQRLVKD
NT seq 408 nt   +upstreamnt  +downstreamnt
atgatcatcccggtcccagtcctgctcatcttgctggcgctgccagcctgccagggccac
gtggctgctcggctgcagacctccatctttctgaaggagagcatcaggctgctgaacgag
ctcctgaagacaaaggtttcctgtgacaacataaacatgacaaatattttctcaggtgat
aaggaatatgatgacatggagaccttatgcaaagccaccacagtagcctgggagggccgg
agctgccacaggcacctggagggcatttacctcaacttgctcagtctggtccaaaggaag
agcccagcccacaaggcaccatgtcccgtggcagccggcaacactacctccctgaatgac
ttcctagtggacttacgcagagtcctccaacgactagtaaaagactag

DBGET integrated database retrieval system