KEGG   Gordonia insulae: D7316_02313
Entry
D7316_02313       CDS       T05722                                 

Gene name
griI
Definition
(GenBank) 2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
gom  Gordonia insulae
Pathway
gom00997  Biosynthesis of various secondary metabolites - part 3
gom01100  Metabolic pathways
gom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    D7316_02313 (griI)
Enzymes [BR:gom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     D7316_02313 (griI)
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AZG45713
UniProt: A0A3G8JL20
LinkDB
Position
2508707..2509543
AA seq 278 aa
MFDSRGVRRQSLSGKQLRLSRLFAASSRRSLVVPIDHSVTIGPLGRSDHADSTADLLARA
GADALIVHKGRARTIDPWRFGSLGLIVHLSAGTNLSIDRTGKVLVGSVEECLGLGADAVS
VHVNVGSASEPQQLIDLGAVSGECSRLGVPLLAMMYARGPEIGVDATSVPTLSHLAAIAT
DLGADVVKLDYAGSPDQMNEVVDSCPLPILVAGGPAVESDAAAIDFGIEVASSRVAGLSF
GRQIFAAEQPQHVAAALADHLHGAAPSSRALTPTLELA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgttcgacagccgcggtgtacgccgacagtcattatccggcaagcaacttcgcctttca
cggctcttcgccgcctcgtcccggcggtctctggtggtgccgatcgaccattcggtgacg
atcggaccactgggccggtcggaccacgcggacagcaccgcggatctcctcgcccgtgcc
ggcgccgacgcgttgatcgtgcacaagggtcgcgcgcgcacgatcgacccatggcgattc
gggtcgctcggcctgatcgtgcatctctctgcgggcaccaacctcagcatcgaccgaacg
ggcaaggtcctcgtcggctccgtcgaggaatgcctgggcctgggcgccgacgcggtgagc
gtgcatgtcaacgtcgggtccgcctccgagccacagcaactcatcgatctcggcgcggtc
tccggcgaatgcagtcgtctcggggtgccgctgctcgcaatgatgtatgcgcgcggcccg
gagatcggcgtcgacgcgacgtcggtgccgacgctctcccatctcgccgccatcgccacc
gacctcggcgccgacgtggtcaagctcgactacgcgggctcgccggatcagatgaacgag
gtcgtcgactcctgcccgctgccgatcctggtcgcgggtggtcccgccgtggagagcgac
gcggcggcaatcgatttcggtatcgaggtcgcatcctcacgcgtcgcgggactcagcttc
ggacggcagatcttcgccgccgagcagccgcagcacgtcgcggccgcactcgccgaccac
ctccatggcgcggcaccctcgtcgcgcgcactgacacccacactcgaactcgcctga

DBGET integrated database retrieval system