Gordonia polyisoprenivorans: GPOL_c43320 Help Entry GPOL_c43320       CDS       T01719                                  Symbol folB Name (GenBank) dihydroneopterin aldolase FolB   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gpo  Gordonia polyisoprenivorans Pathway gpo00790   Folate biosynthesis gpo01100   Metabolic pathways gpo01240   Biosynthesis of cofactors Module gpo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gpo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GPOL_c43320 (folB) Enzymes [BR:gpo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GPOL_c43320 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GPOL_c43320 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GPOL_c43320 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Phage_G Motif Other DBs NCBI-ProteinID:  AFA75335 UniProt:  H6MVN5 LinkDB All DBs Position complement(4919505..4919876) Genome browser AA seq 123 aa AA seqDB search MADRIELKGLRVRGNHGVFEHERHDGQLFIVDATLWADLRSAAASDDLADTVDYGALAHQ IHAIVAGPARNLIETVGAEIADAVMADERILACEIVVHKPSAPIPLAFDDVAVVTRRSRK SVK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggccgatcggatcgagctgaaggggctgcgggtccgtggcaatcatggtgtcttcgag catgaacgccatgacggtcagctcttcatcgtcgacgccacactgtgggccgacctgcgt tccgcggcagccagcgacgacctcgccgacaccgtcgactacggtgcgctggcccaccag atccatgcgatcgtcgcgggcccggcgcggaatctgatcgagacggtcggcgcggagatc gccgacgcggtgatggccgacgagcgcatcctggcttgcgagatcgtcgtgcacaagccg tcggcgccgatcccgttggccttcgacgacgtcgcggtggtcacccgtcggtcgcggaag tcggtcaagtga

DBGET integrated database retrieval system