KEGG   Hipposideros armiger (great roundleaf bat): 109381899
Entry
109381899         CDS       T04661                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03460  Fanconi anemia pathway
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05216  Thyroid cancer
hai05217  Basal cell carcinoma
hai05218  Melanoma
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109381899 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381899 (POLK)
   05202 Transcriptional misregulation in cancer
    109381899 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381899 (POLK)
   05212 Pancreatic cancer
    109381899 (POLK)
   05225 Hepatocellular carcinoma
    109381899 (POLK)
   05226 Gastric cancer
    109381899 (POLK)
   05214 Glioma
    109381899 (POLK)
   05216 Thyroid cancer
    109381899 (POLK)
   05220 Chronic myeloid leukemia
    109381899 (POLK)
   05217 Basal cell carcinoma
    109381899 (POLK)
   05218 Melanoma
    109381899 (POLK)
   05213 Endometrial cancer
    109381899 (POLK)
   05224 Breast cancer
    109381899 (POLK)
   05222 Small cell lung cancer
    109381899 (POLK)
   05223 Non-small cell lung cancer
    109381899 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109381899 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hai03400]
    109381899 (POLK)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     109381899 (POLK)
DNA repair and recombination proteins [BR:hai03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    109381899 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH Olduvai
Other DBs
NCBI-GeneID: 109381899
NCBI-ProteinID: XP_019496550
LinkDB
Position
Un
AA seq 809 aa
MDSTKEKNNNYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYENELKKEKQV
NQRIENMMQQKARITSQQLRKAQLQVDRFAMELEQSRDLNNTMVHIDMDAFYAAVEMRDN
PGLKDKPIAVGSSSMLVSRTKLIKVKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPE
DKRKYFIKTGNSLENDKSGKEINKLSAHERSTSPLLFEDSPPDLQPPGNTSQVNIEEQNN
PQILQNSVVFGTSAEEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQIL
PNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFL
HIALGLGSTYLARDAERKSMSVERTFSEISKAEEQYSLCKELCSELAQDLQKEGLKGRTV
TIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDAEFPHPLRLRLMGVRLSSF
PNEEDKKYQQRSIIGFLQAGNQTLSATQGIEKTDKDQFLKPLEMSHKTSFFDKKRSERKW
NHQDTLKCETMSRQSLQTSPSFQVLKKKMSEDLETSENSDNGQIFTCPVCFREQESISLE
AFNKHVDTCLDGPSLSEMFSYSHASSTEVNKKENVHHSFSLSEKQDYETHQNNPSKAESG
DALSKGECSSLPSKSFNIEHCHQNSSCTISLEKEDVGSLRRQEPLQPYLCEVITDQALVC
PVCNLEQKTSDLTLFNVHVDICLNKSVIQELSKDNQVNQPKENTTGPGNSGRVQKTVTKT
KRSGLMKKYSASKKIKPNNPRHTLDIFFK
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagaacaacaattacaaagatgaccttctgcttagaatggga
cttaatgataataaagctgggatggaaggattagataaagagaaaataaacaaaattata
atggaagccacaaaggggtccaaattttatgaaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcgaattaccagtcagcagctcagg
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgggatctgaat
aataccatggtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccaggattgaaggataaacccattgctgtaggatcatcaagtatgttggtaagtagaaca
aagctaattaaggttaaggaaatacttgctgattatgatcccaattttatggccatgagt
cttgatgaagcctacttgaatataacaaagcacttacaggaaagacaaaattggcctgag
gacaaaagaaagtatttcatcaaaacagggaactctctagaaaacgataaatctggaaaa
gaaattaataaactgagtgcgcatgaacgatccacctctccactactttttgaagatagt
cctcctgatttgcagcctccaggaaatacttcccaagtaaacattgaagaacaaaataat
cctcaaatactccaaaactctgttgtttttggaacgtcagctgaagaagtggtaaaggaa
attcgtttcagaattgagcaaaaaacaacactgacagccagtgcaggcattgccccaaat
acaatgttagcaaaagtatgcagtgataagaataaaccaaatggacagtaccaaattctc
cccaacagacaagctgtgatggacttcatcaaggacttacccattagaaaggtttctgga
ataggaaaagttacagagaaaatgttaaaggcccttggaattattacttgtacagaactc
taccaacagagggcattactttctcttcttttctctgaaacatcttggcattatttcctt
catattgccctgggtctaggttcaacatacctggcaagggatgcagagaggaaaagcatg
agtgttgagaggacatttagtgagataagtaaagcagaagaacagtacagcttgtgcaag
gaactttgcagtgaacttgctcaggatctgcagaaagaaggacttaagggtagaactgtt
actattaagttgaagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatct
gttgtttctactgcagaagaaatatttgctattgctaaagaattgctaaaaacagaaatt
gatgctgagtttccacatcccttgagattgagactgatgggtgtgcggctgtctagtttt
cccaacgaagaagacaagaaataccaacaaaggagcattattggttttctacaagctgga
aaccaaaccctgtcagctactcagggtatagagaaaactgacaaagatcagtttttaaaa
cctttagaaatgtctcataagacaagtttctttgataaaaaacgatcagaaaggaaatgg
aaccaccaagacacacttaaatgtgaaactatgagtagacaaagtttacagacatcacca
tcattccaagttttaaagaagaaaatgagtgaggatttagaaacatcagagaattcagat
aatggtcagatatttacctgtcctgtgtgctttagggagcaagaaagcatcagtctggaa
gcctttaataaacatgtagatacatgtcttgatggaccttcgctcagtgaaatgttctca
tattcacatgcttcctctactgaagttaacaaaaaagaaaatgtacaccattctttttca
ctctctgagaagcaggattatgaaacccatcagaataatccatctaaagcagaaagtgga
gatgctttaagcaaaggggaatgttctagtcttccaagcaaatcgtttaatattgagcac
tgtcatcagaattcttcttgtactatttcactggaaaaagaagatgtcgggtcattaaga
aggcaagaaccactccagccttatttatgtgaagtgataacagaccaagctctagtttgc
cctgtttgtaacctagagcaaaagacttcagatcttaccctgtttaatgtgcatgtggat
atttgcttaaataaaagtgttatccaggaactgagtaaggataatcaagttaaccaaccc
aaagaaaacaccaccggtcctggtaactcaggcagagtacagaagactgtaacaaaaaca
aaaaggtcaggattgatgaaaaagtactcagcatccaagaaaataaaaccaaacaatccc
agacacacacttgatatattttttaaatga

DBGET integrated database retrieval system