KEGG   Hipposideros armiger (great roundleaf bat): 109382336
Entry
109382336         CDS       T04661                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05134  Legionellosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109382336 (APAF1)
   04215 Apoptosis - multiple species
    109382336 (APAF1)
   04115 p53 signaling pathway
    109382336 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382336 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109382336 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109382336 (APAF1)
   05012 Parkinson disease
    109382336 (APAF1)
   05014 Amyotrophic lateral sclerosis
    109382336 (APAF1)
   05016 Huntington disease
    109382336 (APAF1)
   05020 Prion disease
    109382336 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    109382336 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109382336 (APAF1)
   05152 Tuberculosis
    109382336 (APAF1)
  09172 Infectious disease: viral
   05162 Measles
    109382336 (APAF1)
   05164 Influenza A
    109382336 (APAF1)
   05161 Hepatitis B
    109382336 (APAF1)
   05160 Hepatitis C
    109382336 (APAF1)
   05168 Herpes simplex virus 1 infection
    109382336 (APAF1)
   05169 Epstein-Barr virus infection
    109382336 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109382336 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD eIF2A WD40_like Ge1_WD40 CARD_2 AAA_16 Utp8 Hira AAA_22 Cactin_mid
Other DBs
NCBI-GeneID: 109382336
NCBI-ProteinID: XP_019497283
LinkDB
Position
Un
AA seq 1249 aa
MDAKARNCLLQHRKALEKDIKTSYIMDHMISDGFLTVSEEEKVKNEPTQQQRAAMLIKMI
LKKDNYSYISFYNALLHEGYKDLAALLHDGIPVVSFSNGKDSFGRITSYVRTVLCEGGVP
QRPVVFVTRKKLVSAIQQKLSRLNGEPGWVTVYGMAGCGKSVLAAETVRDQDFLERCFPG
GVHWVSVGKQDKAGLLMKLQNLCTRLDEDESFSQRLPLNIEEAKDRLRLLMLRKHPRSLL
ILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESCLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSIFQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGNSFRYHLHDLQVDFLTEKNRSQLQDLHKKIITQFQRHHQPHTLSSDQEDC
MYWYSFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
CANFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLQAKQEVDNGMLYLEWINK
KNIKHLSRLVVRPHTDAVYHACFSANGQRIASCGADKTLQVFKADTGEKLLEIKAHEDEV
LCCAFSTDDKFIATCSVDKKVKIWNSMTGELVHTYDEHSEQINCCHFTKDSHHLLLATGS
SDCLLKLWDLNQKACRNTLFGHTNSVNHCRFSPDDKLLASCSADGTLKFWDVKSANEKKS
IKMKQFFLNSEEPQEDLEVIVKCCSWSSDGSRIMVAAKNKVFLFDIHTSGLLAEIHTGHH
STIQYCDFSPCDLLAVVALSHYCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLTS
SDDQTIRLWETKKVCENSAIVLKQEIDVAFQENEVMVLAADNTRRLQIINGRTGQIDYLT
EAQASCCCFNPRLQLVAFGGNEGAVQILELLNNRIFQSRTGHKNTVRHIQFTADGKTLIS
SSDDSTIQVWNWQSEEYVFLQAHQETVKDFRLLKSSRLLSWSFDGTAKVWNIVTGRLEKD
FVCHQHTVLSCDISSDATKFSSTSADKTAKIWSFECLSPLHELRGHKGCVRCSVFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPVPVEEGAATHGGWVTDLCFSPDSKMLVSAGGYL
KWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILRILE
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagaaaagccctggaaaaggacatc
aaaacatcctacataatggatcatatgattagtgatggatttctaacagtatcagaggag
gaaaaagtaaaaaatgagcccactcaacagcaacgagcagctatgctaattaaaatgata
cttaagaaagataattattcctacatatcattctacaatgctctactacatgaagggtat
aaagatcttgctgcccttctccatgatggcattcctgtggtctctttttccaatggcaaa
gattcatttggtagaataacctcatatgtaaggacagtcctatgtgaaggaggagtacca
cagaggcccgtggtttttgttactaggaagaagctggtgagtgcaattcagcagaaactc
tccagactgaatggcgaaccaggatgggttaccgtgtatggaatggcaggatgtgggaag
tctgtattagctgcagaaaccgttcgagatcaggacttcttagaacgttgtttcccaggg
ggtgtgcattgggtttctgttgggaagcaagacaaagctgggcttctgatgaaactgcag
aatctttgtacacggttggatgaggatgagagtttctcccagaggcttccacttaacatt
gaagaggctaaggaccgtctccgccttctgatgctgcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcaatgtcagatt
cttcttacaaccagagacaagagtgttacagactcagtaatgggtcctaaatatgtagtc
cctgtggagagttgcttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcatagtattataaaagagtgtaaaggttct
cctctcgtggtgtctttaatcggtgcacttttacgtgattttcccaaccgctgggagtac
tacctcaggcaacttcagaataagcaatttaagaggataagaaaatcttcatcttatgat
tatgaggctctggatgaagccatgtctatcagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttctatctttcagaaggatgttaaggtgcctacaaaggtgtta
tgcattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgttaat
aagtccctcttattttgtgatcggaatggaaattcatttcgctatcatttacatgatctt
caagtagattttcttacagagaagaatcgcagccagcttcaggatctacataagaagata
atcactcagttccagagacatcaccagccacacactctctcatcggatcaggaggactgc
atgtactggtacagttttttggcctatcacatggccagtgccaatatgcacaaagaactt
tgtgctttaatgttttccctggattggattaaagctaaaacggaactcgtaggtcctgct
catctgattcatgaatttgtggaatacaggcatatactggatgaaaaggactgtgcagtc
tgtgcgaatttccaggagtttttatctttaaatggacatcttcttggacgacaaccattt
cctaatattgtacaattgggtctctgtgaaccggaaacttcagaagtttatcgccaagct
aagctgcaggccaagcaggaggtcgataacggaatgctttacctggagtggataaacaaa
aaaaacatcaagcatctctcccgcttagttgtccgcccccatacagatgctgtttaccat
gcttgcttttctgcaaatggtcaaagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgacacaggagagaaacttctagaaatcaaggctcatgaggatgaagtg
ctttgctgtgcattttctacagatgacaaatttatagcaacttgctcagtggataagaaa
gtgaagatttggaattctatgactggggaactagtacatacctatgatgagcactcagag
caaatcaattgctgtcacttcaccaaagacagccatcaccttctcttagccactgggtca
agtgactgcctcctcaaactctgggatttgaatcaaaaagcatgtcgaaataccctgttt
ggccataccaattcagtcaatcactgcagattttcaccggacgataagcttttggctagt
tgttcagctgatggaacattaaagttttgggatgtgaaatcagccaatgagaagaagagc
attaagatgaagcagttcttcctaaattcagaggagcctcaagaggatttggaagtgata
gtgaaatgctgttcatggtcttctgatggatctaggataatggtggcagcaaaaaataaa
gtctttctttttgacattcataccagtggtctattggcagaaatccatacaggccatcac
agcaccatccagtactgtgacttctccccctgtgaccttttggcagtggtggctttgtcc
cattactgtgtggagttgtggaatatggactcttgtctaaaagtagctgactgcagagga
catttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgacatct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtgagaactctgctata
gtactaaagcaagaaatagatgttgcatttcaagaaaatgaagtgatggttcttgcagct
gacaatacaagacgtctgcaaatcattaatggaagaacaggtcagatcgattatctgact
gaagcgcaagctagctgctgttgcttcaacccacgtctgcagctcgttgcatttggaggc
aacgaaggagccgttcagattttagaactcctaaacaacagaatcttccagtccaggact
gggcacaagaacactgtacggcacatccagttcacagctgatgggaagactcttatttca
agctctgatgattctacaattcaggtgtggaattggcaatcagaggaatatgtctttctg
caagcccatcaggaaacagtgaaagactttaggctcttgaaaagttcaagactgctttct
tggtcatttgatggaacggcgaaggtatggaatattgttactggaagactagaaaaagac
tttgtctgtcaccagcatacggtactttcttgtgatatttcttctgatgctaccaagttt
tcatctacctctgctgacaagactgcaaagatttggagttttgaatgcctttcacctctg
catgaactgaggggccacaaaggctgtgtgcgctgctcggtcttctctgtggacagcacc
ctgctggcgactggcgatgacaatggagaaatccggatatggaacgtctcaaacggcgag
cttcttcacttgtgtgctccggttccggtagaagaaggagctgccactcacggaggctgg
gtgaccgacctctgcttttctccagatagcaaaatgcttgtctctgctggaggctatctt
aagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaatggaaccaat
cttaagaaaatacatgtgtctcctgacttcaaaacatatgtgactgtagataatcttggt
attttatatattttacggatattagagtaa

DBGET integrated database retrieval system