KEGG   Hipposideros armiger (great roundleaf bat): 109385455
Entry
109385455         CDS       T04661                                 

Gene name
EIF2AK2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04141  Protein processing in endoplasmic reticulum
hai04217  Necroptosis
hai05010  Alzheimer disease
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109385455 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109385455 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109385455 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385455 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    109385455 (EIF2AK2)
   05164 Influenza A
    109385455 (EIF2AK2)
   05160 Hepatitis C
    109385455 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    109385455 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385455 (EIF2AK2)
   05169 Epstein-Barr virus infection
    109385455 (EIF2AK2)
   05165 Human papillomavirus infection
    109385455 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109385455 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109385455 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109385455 (EIF2AK2)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109385455 (EIF2AK2)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   109385455 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109385455 (EIF2AK2)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     109385455 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Kdo Macoilin Kinase-like
Other DBs
NCBI-GeneID: 109385455
NCBI-ProteinID: XP_019503325
LinkDB
Position
Un
AA seq 537 aa
MEPVISIPTPTPKCLCGRGNGMFDPRAWFSECLARRGRSETSVSFPPPADPYLHGGLTAS
EARVGIQALGRAPRSRGGTWVPSPPRDAFRADFPWRPPSPEIPELVRRSQAEGPEAEGGV
RGENETETGLPRPGCVSVTVAARAAFHCKCIIGQKVWGDAVGSTKQIAKQLAAKIAYVQI
EKTSTKDDIASLVSSSPGFSDDRSNSSETSTSDSESPPESGFSASGSERNDTSDSFSSSS
SSVNNLKNSHRKVKGNEYTMDKRFLKDFLEITPIGLGGYGDVFKAKHRIDGKTYVIKRVE
YDNQKVEREVKALAKLDHKNIVRYCSCWDGTDFALEDSNNKRSLTKCLFIQMEFCDQGTL
EQWLDNRRKKEPNKCLSLELYEQIVVGVDYIHSEGLIHRDLKPSNIFLVGTKQIKIGDFG
LVTFLTHDENRTDDKGTPIYMSPEQLSSVQYGNEVDIFALGLILAELLYICRSRTETLET
FQHLKDGNPSDKFDEKENILLLKLLSKDPKKRPKTSEILKTLKEWKNVPEKKKRNTH
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggagccggtaatatccatcccgacccccacccccaaatgtttgtgtggaagaggaaat
gggatgtttgatcctagagcctggttcagcgagtgcctggcacgccgcgggcgctcggag
acctccgtgtccttcccacctcctgcggatccttatctgcacgggggcctgacagcctcg
gaagcccgggtggggatacaagcgcttggacgcgcgcccagaagcaggggcggcacgtgg
gtgccgagcccaccccgcgatgccttccgcgcggacttcccatggaggcctccgtctccc
gagatcccggagctagtgaggaggagccaggccgaagggccggaggcggaaggcggagtt
cgcggagaaaacgaaactgagactgggttgcccagacccggctgtgtctcggtgacagtg
gcggctcgcgctgcatttcattgtaaatgcataattggacagaaagtatggggtgatgct
gtaggttctactaaacagattgcaaaacaattggctgcgaaaattgcgtatgtgcagata
gaaaaaacctcaacgaaagatgacatagcttccctcgtttcttcctctcctgggttcagt
gacgacagaagtaattcttcggagacaagcacatctgattctgaatcaccgcccgaaagt
ggcttttcagcaagtggatcagaaagaaatgataccagtgacagttttagcagttcttca
tcgtctgtgaacaatctcaaaaacagtcacaggaaggtgaaaggaaacgagtatactatg
gataaaaggtttctcaaggatttcctagaaataacaccaattggcttaggcggatatggc
gacgttttcaaagcaaaacacagaattgatggaaagacttatgttattaaacgtgttgaa
tacgataaccagaaggtagagcgtgaagtaaaagctttggcaaagcttgatcataaaaat
attgtccgttactgtagttgttgggatggaactgattttgctcttgaggacagcaacaac
aaaaggtcattgactaagtgccttttcatccaaatggaattctgtgatcaaggtacattg
gaacagtggcttgacaacagaagaaaaaaggaaccaaacaaatgtttgtctttggaatta
tatgagcaaatagtagtaggagtggattatatacattcggaagggttaattcatcgagat
cttaagcccagtaacatatttttagtaggtacaaaacaaataaagattggagactttgga
cttgtaacattcctgacacatgatgaaaatcggacagatgataagggaactccaatatac
atgagcccagaacagctttcttcagtacaatatggaaatgaagtggacatctttgctcta
ggactgatacttgcagagcttctttatatatgtcgctctcgtacagaaacacttgagact
tttcaacatttaaaggatggcaatccctcagataaatttgatgaaaaagaaaatattctt
ctactgaaattactctcaaaggatcccaagaaacgacctaaaacatctgaaatacttaag
actttgaaggagtggaagaatgttcctgagaaaaagaaacgaaacacacattag

DBGET integrated database retrieval system