KEGG   Hipposideros armiger (great roundleaf bat): 109391076
Entry
109391076         CDS       T04661                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai05133  Pertussis
hai05135  Yersinia infection
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109391076 (IRF3)
   04621 NOD-like receptor signaling pathway
    109391076 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    109391076 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    109391076 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109391076 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109391076 (IRF3)
   05133 Pertussis
    109391076 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109391076 (IRF3)
   05162 Measles
    109391076 (IRF3)
   05164 Influenza A
    109391076 (IRF3)
   05161 Hepatitis B
    109391076 (IRF3)
   05160 Hepatitis C
    109391076 (IRF3)
   05168 Herpes simplex virus 1 infection
    109391076 (IRF3)
   05163 Human cytomegalovirus infection
    109391076 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109391076 (IRF3)
   05169 Epstein-Barr virus infection
    109391076 (IRF3)
   05165 Human papillomavirus infection
    109391076 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109391076 (IRF3)
   04131 Membrane trafficking [BR:hai04131]
    109391076 (IRF3)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    109391076 (IRF3)
Membrane trafficking [BR:hai04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    109391076 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 109391076
NCBI-ProteinID: XP_019513839
LinkDB
Position
Un
AA seq 421 aa
MGTQKPRILPWLVSQLDGGQLEGVAWLDQSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
SGAYTPGKDKPDLPTWKRNFRSALNRKEVLRLAEDRSKDPHDPHKIYEFVTSGSGDFPEV
DTSPDTNGRYSTSDTQEDTLEELLNDLALVPTPSEGPLSLAATAEDPLPLLMSPNLDVPA
PYPNPEPPENPLKQLLVPEEEWEFEVTAFYRGRQVFQQTVFCPKGLRLVGSEAGDRTLPG
QPIILPDPGASLTDRGVVGYVRRVLNSLGNGLALWRAGQWLWAQRLGHGHTFWAVGEEFL
PDSGHGHDGEVPKDKEGSVFDLRPFVTDLIAFIEGSGRSPRYTLWFCVGELWPQNQPWTK
KFLMVKVVPTCLRSLLEMARLGGASSLENTVDLHISNSHPFTLTSDQYKACLQDLVEDMD
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggaacccaaaagccgcggatcctgccctggctggtgtcgcagctcgacgggggacag
ctggagggcgtggcctggctggaccagagccgcacgcgcttccgcataccctggaaacac
ggtttgcggcaggatgcccagcaagaagactttggcatctttcaggcctgggctgaggcc
agtggtgcctatactccggggaaggataagcccgacctgcccacctggaagaggaatttc
aggtcggccctgaaccgtaaggaagtgttgcgtttagctgaggaccggagcaaggaccct
catgacccacacaagatctatgagtttgtgacctcaggaagtggggactttcctgaggtg
gacacctctccagacaccaatggcagatacagtacctctgatacccaggaagatactcta
gaggaattactgaatgatctggccttggtcccaaccccaagtgagggacccttgagcctg
gctgcaactgctgaagacccccttccgctcttgatgagccccaacttagacgtccctgct
ccctacccaaacccagagccccctgagaacccactcaagcagctattggtgcccgaggaa
gagtgggaatttgaggtgaccgccttctaccggggccgccaagtcttccagcagactgtc
ttctgcccaaagggcctgcggttggtagggtcagaagcaggggacaggacactgcctggg
cagccaataatactgccagaccccggggcgtccctgacagacaggggcgtggtgggctac
gtgaggcgtgtgctgaacagcctgggcaatggactagctctgtggagggcagggcaatgg
ctctgggcccagaggctggggcatggccataccttttgggctgtgggcgaggagttcctc
cctgacagtggtcacgggcatgatggtgaggtacccaaggacaaggaaggaagcgtgttt
gacctgaggccctttgtaacagatctgattgccttcatcgaaggaagcggacgctcacca
cgctacaccctctggttctgcgtgggggagttatggccccagaaccagccatggaccaag
aagttcttgatggtcaaggttgttcccacatgtctcagatccttgctagaaatggcgcgg
ttagggggtgcctcctcactggagaacactgtggacctacacatttccaacagccaccca
ttcaccctcacttcggaccagtacaaggcctgcctccaggacctggtcgaggacatggat
ttctag

DBGET integrated database retrieval system