KEGG   Hippocampus comes (tiger tail seahorse): 109514392
Entry
109514392         CDS       T04969                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109514392
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109514392
   04114 Oocyte meiosis
    109514392
   04115 p53 signaling pathway
    109514392
   04218 Cellular senescence
    109514392
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109514392
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109514392
   03036 Chromosome and associated proteins [BR:hcq03036]
    109514392
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109514392
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109514392
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA
Other DBs
NCBI-GeneID: 109514392
NCBI-ProteinID: XP_019723017
UniProt: A0A3Q2YNP5
LinkDB
Position
Unknown
AA seq 385 aa
MSSMEVRSVQLPVTDNPPKMTKPTAAVTRRAALVERTNVLVSGVNIKERGHGKATGVRKV
NAVAPFQVKAAADTLLVSEASTDVSMKEEEEVELCQAFSNALLPVDDVDEDDANMPQLCS
EYVKDIYRYLHQLEVEQPVHANYMQGYEITDRMRALLIDWMVQVHSRFQLLQETLYLSVA
VLDRFLQIQPVSRRKLQLVGVTAMLVASKYEETYPPIVGDFAYVTDSAFTNAQILEMEQL
VLKSLNFQLGRPLPLHFLRRASKVANSDVERHTLAKYLMELTLIDYEMVHYRPSEIAAAA
LCLSQLLLNELPWSTTQEHYSTYSEAHLKPIMQHIAKNVVRVNGGKTKFQAVRNKYSSSK
LMKISQIPQLNSPLISNLAACLDAP
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtcgtccatggaagtccggagtgtgcagcttccagtgactgataaccccccaaagatg
actaaaccaacagcagctgtaacgaggcgagctgctctcgtcgagcgaaccaatgtgctc
gtgtcaggagtcaacataaaggaaaggggacatggcaaagcaactggagttcggaaagtc
aatgccgttgctccatttcaagttaaggcagcagcagacacccttctggtttcagaggca
tcaactgatgtgtccatgaaggaagaggaggaggtagaactgtgccaggctttctccaat
gcactgctcccagtggatgatgtagatgaggatgatgccaacatgccccagctgtgctcc
gaatacgtaaaagacatctacagatatctgcaccaattggaggtagagcagcctgtacat
gccaactacatgcagggttatgaaatcactgaccgcatgcgagcccttcttattgactgg
atggttcaggttcattccagattccagctgctgcaagagaccttgtatctctctgttgcg
gtccttgaccgatttctccagatccagccagtctctcgtagaaagctgcagctcgtcggt
gtgactgcaatgctggttgcctccaagtatgaggagacttatcctccgatagtgggagac
tttgcctatgttacggacagcgcgttcaccaatgctcagattttggagatggaacaactg
gttctaaagagcctcaactttcagcttggacgtccgcttccgctacacttcctcaggaga
gcttcaaaagtggccaattctgatgtggaaaggcacacgctggccaagtatctgatggag
ttgaccctcattgactacgaaatggtgcattatcgcccttctgagatcgctgcagcggct
ctgtgcctctctcagctgctgctgaatgaactcccttggtcaaccacacaggaacactac
tcgacatatagcgaggcccacctgaagcccatcatgcagcacatcgccaaaaatgttgtg
agggtaaatggtgggaaaactaaattccaggctgtcaggaataagtactcaagcagcaag
ttgatgaagatcagccagattccacaactcaattcaccgcttatcagcaacctggcagcc
tgtcttgatgccccttga

KEGG   Hippocampus comes (tiger tail seahorse): 109527096
Entry
109527096         CDS       T04969                                 

Gene name
ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1 isoform X1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109527096 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109527096 (ccnb1)
   04114 Oocyte meiosis
    109527096 (ccnb1)
   04115 p53 signaling pathway
    109527096 (ccnb1)
   04218 Cellular senescence
    109527096 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109527096 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109527096 (ccnb1)
   03036 Chromosome and associated proteins [BR:hcq03036]
    109527096 (ccnb1)
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109527096 (ccnb1)
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109527096 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VitD-bind_III
Other DBs
NCBI-GeneID: 109527096
NCBI-ProteinID: XP_019744362
UniProt: A0A3Q2YKP0
LinkDB
Position
Unknown
AA seq 396 aa
MAFRATRNRLTSTRTDLASKTCSVTGPPLKTRAALGDIGNVPGSKQPQKAVKAHAVKKTK
APVVTEKAEPKAQNVPVVQVVPVPEPESVSPTPMETSGCEPADLCQAFSDVILHSTIKDV
DADDYDNPMLCSEYVKDIYKYMRQLEAEQNVRANYLKDQEVTGNMRAILVDWLVQVSLKF
RLLQETMYMTVGIIDRFLQDNPVPKKQLQLVGVTAMFLASKYEEMYPPEIMDFALVTDQA
YTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIHEVTAEQHTLAKYLLELTMIDYQM
VHYPPSMAASAALALTLKLLDAGEWDATLQHYMDYTADSLVPVMAHIARNVVKVNEGQTK
HMAVKDKYSTSKQMRIATISQLKSSVVKDLLKQLTQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcttttcgcgctacaagaaaccgcttgacctccacccggactgacctcgcttcaaag
acatgctccgtcactgggcccccactcaagacgcgagccgctcttggggacattggtaat
gtcccaggcagcaaacagccccagaaggcagtcaaggcacacgctgttaaaaagaccaaa
gcacccgttgtgactgaaaaggctgagcctaaagcacaaaatgttcctgtggtacaggtg
gtgccggtgcctgaacccgagtcagtgtctccaactccaatggagacctcaggctgtgag
ccagctgacttgtgtcaagcattttctgatgttattctccacagcactatcaaggatgtg
gatgccgatgactacgacaacccgatgctctgcagcgaatatgtaaaagatatatacaag
tatatgcgtcagctggaggctgagcagaatgtccgagccaattatcttaaagaccaggaa
gtgaccggcaacatgcgggccatacttgtcgactggctagtccaagtgagcctgaagttc
cgcctgctgcaggagactatgtacatgactgtgggaataattgaccgctttcttcaggac
aacccagtccccaagaagcagctgcagcttgtcggagtgaccgccatgttcctagcttca
aagtacgaggagatgtatccaccagagatcatggactttgccttggttacggatcaggcc
tacactactgcccaaatcagagatatggaaatgacaatcctgcgtgtgctaaaatttcaa
cttggccgccctctccctctgcaattcctcagaagggcctcaaagattcatgaagtgact
gcagagcagcacaccctggcaaaatacttgctcgagctgaccatgatcgactaccaaatg
gttcattacccgccttcaatggcggcaagtgccgcgttggcgctcacgctcaagctgctg
gatgcgggagaatgggacgcaacgctgcaacattacatggactacaccgccgacagtttg
gttccagtcatggcacacattgccagaaatgttgtcaaggtgaatgaaggtcaaacgaag
catatggctgtcaaagacaagtactctacttcaaaacagatgaggattgcaacgatctca
cagctcaagtcttccgttgtgaaagatcttttgaagcagctaacgcagtga

DBGET integrated database retrieval system