KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2300Help
Entry
HDEF_2300         CDS       T00911                                 

Gene name
fabA
Definition
(GenBank) beta-hydroxydecanoyl thioester dehydrase (trans-2-decenoyl-ACP isomerase)
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde01100  Metabolic pathways
hde01212  Fatty acid metabolism
Module
hde_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_2300 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_2300 (fabA)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HDEF_2300 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     HDEF_2300 (fabA)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_2300 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACQ68838
UniProt: C4K8W9
LinkDB All DBs
Position
2067202..2067717
Genome map
AA seq 171 aa AA seqDB search
MMNEDGAYSKKDLEASSRGELFGPKGPRLPASNMLMIDRVITMTKDGGMHGKGYVEAELD
VHPNLWFFGCHFIDDPVMPGCLGLDAMWQLVGFYLGWLENEGKGRALGVGEVKFKGQVLP
DSKKITYCIDFKKVITGKLIMGIADGKVLSDGQQIYTADDLKVGLFKNTSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgaagatggtgcctattccaaaaaagatttagaagcttcatcacgtggcgag
ttatttggtccaaaaggacctcgtctgcccgccagcaacatgttaatgattgaccgtgtc
attaccatgaccaaggatgggggtatgcatggtaaaggttacgtggaagcagaattagat
gtccatcccaatctgtggttttttggttgccattttattgatgatcctgttatgccaggt
tgtctgggcttagatgccatgtggcaattggtcggattttatcttggctggttagagaat
gaaggcaaaggacgtgcgttaggggtcggagaagtcaagtttaagggccaggttttacct
gattcaaaaaaaatcacttattgtattgattttaaaaaagtgatcacgggtaaattaatt
atggggatagcagacggtaaagtgttgtcagacggccagcaaatttacaccgccgatgat
ctcaaagtgggattatttaaaaatacttcgttttag

DBGET integrated database retrieval system