KEGG   Heterocephalus glaber (naked mole rat): 101712077
Entry
101712077         CDS       T02812                                 

Gene name
Ikbkg
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01523  Antifolate resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04062  Chemokine signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04668  TNF signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05212  Pancreatic cancer
hgl05215  Prostate cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05340  Primary immunodeficiency
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101712077 (Ikbkg)
   04014 Ras signaling pathway
    101712077 (Ikbkg)
   04064 NF-kappa B signaling pathway
    101712077 (Ikbkg)
   04668 TNF signaling pathway
    101712077 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    101712077 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101712077 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101712077 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    101712077 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    101712077 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    101712077 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    101712077 (Ikbkg)
   04660 T cell receptor signaling pathway
    101712077 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    101712077 (Ikbkg)
   04659 Th17 cell differentiation
    101712077 (Ikbkg)
   04657 IL-17 signaling pathway
    101712077 (Ikbkg)
   04662 B cell receptor signaling pathway
    101712077 (Ikbkg)
   04062 Chemokine signaling pathway
    101712077 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101712077 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101712077 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101712077 (Ikbkg)
   05203 Viral carcinogenesis
    101712077 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101712077 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101712077 (Ikbkg)
   05221 Acute myeloid leukemia
    101712077 (Ikbkg)
   05220 Chronic myeloid leukemia
    101712077 (Ikbkg)
   05215 Prostate cancer
    101712077 (Ikbkg)
   05222 Small cell lung cancer
    101712077 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    101712077 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101712077 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101712077 (Ikbkg)
   05135 Yersinia infection
    101712077 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101712077 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    101712077 (Ikbkg)
   05162 Measles
    101712077 (Ikbkg)
   05164 Influenza A
    101712077 (Ikbkg)
   05161 Hepatitis B
    101712077 (Ikbkg)
   05160 Hepatitis C
    101712077 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    101712077 (Ikbkg)
   05163 Human cytomegalovirus infection
    101712077 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101712077 (Ikbkg)
   05169 Epstein-Barr virus infection
    101712077 (Ikbkg)
   05165 Human papillomavirus infection
    101712077 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101712077 (Ikbkg)
   05142 Chagas disease
    101712077 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101712077 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101712077 (Ikbkg)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101712077 (Ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL
Other DBs
NCBI-GeneID: 101712077
NCBI-ProteinID: XP_004875077
LinkDB
Position
Un
AA seq 485 aa
MDSSIGGRGLSAESQLPHTPSCLLLLFPLGLTRDRTCSPCFSSGPVVGRVAVCWAPVTQG
TGEALPWWMSRHPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMLQLRAEQGSPEALQ
RCLEENHELRDAIRQSNQMLRERCEELLHFQASQREEKEFIMCKFQEARKLVERLSLEKL
ELRKQKEQAVQEVEQLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLESATKERQALEA
RARVASEQVRQLEKEREVLQQQHSVQVDQLRMQNQSMEAALRMERQAASEEKRKLAQLQV
AYHQLFQDYDNHIKSSVVSGERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK
MVMETVPVLKAQADIYKADFQAERQAREKLAEKKEVLQEQLDQLQREFGKLKASCQESAR
IEDLRKRHVEVPQPALPPTSVHHSFHMPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHV
MECIE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggactccagtattggtggcaggggactgtctgctgagtcacagttgccccacacccca
agctgtttgctcttgctgttccctttgggattaactagagacagaacctgctcaccttgt
ttcagctcaggccctgtggtcggtcgagtggcagtctgctgggctccagtcacccaaggg
acaggcgaggcactgccgtggtggatgagcaggcacccctggaagagccagctgtgtgag
atggtgcagcccagcggtggcccagcaggggaccaggacgtgctgggtgaagagtcctct
cttgggaagccggcgatgctgcagctgcgcgcggagcagggcagccctgaggccctccag
cgctgtctggaggagaatcatgaactccgagatgccatccggcagagcaaccagatgttg
cgtgagcgctgcgaggagctgctgcacttccaggccagccagagggaggagaaggaattc
atcatgtgcaagttccaggaggccaggaagctggtggagaggctgagcctggagaagctg
gagctgaggaagcagaaggagcaggctgtgcaggaggtggagcagctgaagagatgtcag
cagcagatggctgaggacaaggcttctgtgaaagcccaggtgacatccttattgggggaa
ctccaggagagccagagccgcttggagtccgccaccaaggaacggcaggctttggaggcc
agggcgcgggtggccagtgagcaggtgcgccagctggagaaggagcgtgaggtgctgcag
cagcagcacagtgtgcaggtggatcagctgcgcatgcagaaccagagcatggaggctgca
ctgcgtatggagcgccaggccgcctcagaggagaagcggaagctggcccagctgcaggtg
gcctatcaccagctcttccaggactatgacaaccacatcaaaagtagcgtggtgagcggt
gagcgcaagcgagggatgcagctggaggacctgaagcagcagctgcagcaggccgaggag
gcccttgtggccaagcaggaggtgattgacaagctgaaagaggaggctgagcagcacaag
atggtgatggagacggtgccagtcctaaaggcacaggcggacatctacaaggccgacttc
caggcagagcggcaggcccgggagaaactggcagagaagaaggaggtgctgcaggagcag
ctggaccagctgcagcgcgagttcggcaagctcaaggccagctgccaggagtcggccagg
atcgaggacctgaggaagcggcatgtagaggtcccgcagcctgcactgccccctacctct
gtgcaccactcctttcacatgcccaaccagaggaggagtccccctgaggagccccccgac
ttttgctgtcccaaatgccagtatcaggcgcctgacatggacaccctgcagatccacgtc
atggagtgcatcgagtag

DBGET integrated database retrieval system