KEGG   Heterocephalus glaber (naked mole rat): 101717788Help
Entry
101717788         CDS       T02812                                 

Gene name
Shc4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04062  Chemokine signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04510  Focal adhesion
hgl04650  Natural killer cell mediated cytotoxicity
hgl04722  Neurotrophin signaling pathway
hgl04910  Insulin signaling pathway
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04935  Growth hormone synthesis, secretion and action
hgl05034  Alcoholism
hgl05100  Bacterial invasion of epithelial cells
hgl05206  MicroRNAs in cancer
hgl05214  Glioma
hgl05220  Chronic myeloid leukemia
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101717788 (Shc4)
   04012 ErbB signaling pathway
    101717788 (Shc4)
   04072 Phospholipase D signaling pathway
    101717788 (Shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101717788 (Shc4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101717788 (Shc4)
   04062 Chemokine signaling pathway
    101717788 (Shc4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101717788 (Shc4)
   04915 Estrogen signaling pathway
    101717788 (Shc4)
   04917 Prolactin signaling pathway
    101717788 (Shc4)
   04926 Relaxin signaling pathway
    101717788 (Shc4)
   04935 Growth hormone synthesis, secretion and action
    101717788 (Shc4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101717788 (Shc4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101717788 (Shc4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101717788 (Shc4)
   05226 Gastric cancer
    101717788 (Shc4)
   05214 Glioma
    101717788 (Shc4)
   05220 Chronic myeloid leukemia
    101717788 (Shc4)
   05224 Breast cancer
    101717788 (Shc4)
  09165 Substance dependence
   05034 Alcoholism
    101717788 (Shc4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101717788 (Shc4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101717788 (Shc4)
   01522 Endocrine resistance
    101717788 (Shc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 101717788
NCBI-ProteinID: XP_012929931
LinkDB All DBs
Position
Un
AA seq 533 aa AA seqDB search
MRGSGQDSLTGLALCAGLSGPPGMLQRAKYSRFRNEPVQLAEEGGSKGAPQPARLAREPP
EDSASPTRDGPTPLCTLVPRVASVKLANPAALLSLKNFCLGTKEAPGPRVRESRDPAPAP
PPPEPCLPGPAEPSVRGRRDQPGPKQHLLGAGLSYRVRYMGCIEVLQSMRSLDFGMRTQV
TREAISRLCEAVPGASGAIKKRKAPVKFLSAVLGKSNLQFSGMNIKLTISTGSLTLMKLD
NQQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECRSGTAQDVISTIGQA
FELRFKQYLRNTSLNISCESEEVQTDSPASEGEDHEYYNEIPGKQLPAGGVSDLRIRVQS
PEQRAYCPIRCEKLCYLPGNSKSSSAYENCLEQSRAAEALEAVQPGATAQPTSSCSLLHI
KQQLWNEDCYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVLSGLQGSQAKHLLLVDPE
GKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVTLKQPVRKEDNPGLLHFKK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcagcggccaggacagtctgacggggctcgcgctgtgcgccgggctctcggga
cccccggggatgctgcagcgggccaagtacagccgcttccgcaacgagccggtccagctg
gccgaggagggcgggagcaagggcgccccgcagccggcccgcctcgcccgggagcccccc
gaggactccgcctcgcccacccgggacggccctaccccgctgtgcaccctggtaccccgc
gtggccagcgtgaagctggccaacccggccgctctgctgagcctgaagaacttttgcctg
ggcaccaaggaggctcccgggccgagggtgcgggagagccgggaccccgcgccagccccg
ccgccccccgagccctgcctgcccgggcccgcagagccgagcgtccggggcaggcgggac
cagccgggcccgaagcagcacctgctgggagccggcctgagctaccgcgtacggtacatg
ggctgcattgaagtgctgcaatcgatgaggtccctggatttcggaatgaggacccaagtt
acaagggaagcgataagccgcctgtgtgaagctgtccctggggccagtggagccattaaa
aagagaaaggctcctgttaagttcctctcagcagttcttggcaaaagtaatcttcagttt
tctggaatgaatataaaactgaccatctcaacgggcagccttacactgatgaaacttgat
aaccagcagatcattgcaaatcatcatatgcaatctatttcatttgcttctggaggggat
cctgatactacagactatgttgcctacgtagctaaagatccagttaatcaacgagcatgc
cacatattggaatgccgcagcggaacggcccaggatgtcataagcaccatcgggcaggct
tttgaactccgattcaaacagtacttgagaaatacttctctgaacatttcttgtgaaagt
gaggaggtgcagactgacagccccgcctcggagggagaagatcatgaatattacaacgag
atcccaggcaagcagctgccggcaggcggcgtgtcagaccttcggatcagagtgcaaagc
cctgagcagagggcgtactgccccattcgctgtgaaaagctgtgctacttgcctgggaac
tccaagagcagcagtgcgtatgagaactgtctggaacaaagcagggcagcagaggccctg
gaggccgtgcagcctggtgccacagcccagcccaccagctcatgttctttgctgcacatc
aagcagcagctgtggaatgaagactgctaccatggcaagctgagcaggaaggcagcagag
agccttctggtgaaggatggggactttttggttcgagagagtgcaacatcccccggccag
tatgtactgagtggattacagggcagccaggcaaaacaccttctcctggtggatcctgaa
ggcaaggtgaggaccaaggatcatgtattcgataatgttgggcaccttatcagataccat
atggataacagtttgcccatcatctcttctggaagcgaagtaaccctcaaacaaccggtg
agaaaagaagataaccccggacttttgcatttcaagaaatga

DBGET integrated database retrieval system