KEGG   Heterobasidion irregulare: HETIRDRAFT_389219Help
Entry
HETIRDRAFT_389219 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hir  Heterobasidion irregulare
Pathway
hir00500  Starch and sucrose metabolism
hir00520  Amino sugar and nucleotide sugar metabolism
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
hir01130  Biosynthesis of antibiotics
hir01200  Carbon metabolism
Module
hir_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hir_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HETIRDRAFT_389219
   00051 Fructose and mannose metabolism
    HETIRDRAFT_389219
   00052 Galactose metabolism
    HETIRDRAFT_389219
   00500 Starch and sucrose metabolism
    HETIRDRAFT_389219
   00520 Amino sugar and nucleotide sugar metabolism
    HETIRDRAFT_389219
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HETIRDRAFT_389219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hir04131]
    HETIRDRAFT_389219
Enzymes [BR:hir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     HETIRDRAFT_389219
Membrane trafficking [BR:hir04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    HETIRDRAFT_389219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 20672396
NCBI-ProteinID: XP_009551104
JGI: Hetan2_389219
UniProt: W4JX14
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MPASRRGSGSVTLPTGQVLAIHTRTQDEEDLPHATKKTMADHLRKYESLFTLTPQRMRMI
VEAFKDTLEIGLEKPGQTVPMIPTFVFGWPTGTETGDYLALDLGGTNLRVCLVTLQGEGK
FEITQSKYRLTEEQKQEDGQKLFDFCAECLKTFVTTNLDEGTIKEGERLPLGFTFSYPCT
QERIDQGVLIRWTKGFGAADTEGHDVAEMFKRSLEKHDVPVELTALINDTTGTLIASHYV
NPRTKIAVIFGTGCNAAYMERIGGIPKIKNLGCDDDDEMAINCEWGAFDSFEHEHLPRTK
YDLTIDESSNKPGEQAFEKLISGRYLGEILRLVICELIDDGVLFLGQNTYKIEIAYALDT
AFLSLMESDPTEELLMIIGIFSHFFALETTLAERQFFRALAKLVGRRAARLSACGIAAIV
SKMGYLEEGCSVGADGSLYNKYPGFADRVHEGLQDIFGDKGRNIITHHAEDGSGVGSAII
AAMTKIRKDKGQYLHV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccagcatctcgcagaggaagtggtagcgtcaccttgcccaccgggcaggtactggcg
atccataccagaactcaggatgaggaggatctccctcatgcgaccaagaagactatggca
gatcaccttcgcaaatatgagagcttgttcactctcaccccgcagaggatgcggatgatt
gttgaggcattcaaggatactttggaaatcggcctggagaaaccgggtcagaccgtcccc
atgatcccaacctttgtcttcggctggcccaccggcacggaaaccggagattaccttgct
cttgacctcggcggaacgaatctccgtgtctgtcttgtcactctccagggcgagggaaaa
ttcgagattacgcagtcaaaataccgtcttaccgaggagcagaaacaggaagacggacaa
aagcttttcgatttttgcgcggaatgcctgaagacgtttgtcacgaccaacttggatgag
gggaccatcaaagagggagagcgcttgcctcttggatttacgttctcgtatccgtgcacc
caggaacgcatcgaccaaggtgttcttattcgttggaccaaaggctttggagccgccgat
acggaaggccacgatgtcgcagagatgtttaagagaagtctagagaagcatgacgtacct
gtagagttgaccgctctcatcaacgatacgactggcacgctcattgcctcacactacgtc
aacccacgcacgaagatcgccgtgatcttcggaactgggtgcaatgcggcctatatggag
cgtattggtggcatccctaaaatcaagaatttaggatgcgacgacgatgacgaaatggcc
atcaattgtgaatggggcgcgttcgattcgttcgaacatgagcacctgccaaggacaaag
tatgatttgacgatcgacgagagctcaaacaagccgggtgagcaggcttttgagaaattg
atctcaggtcgttaccttggcgagattctgcgtctcgtcatctgcgagctcatcgatgac
ggcgttcttttccttggccaaaacacatacaaaattgagatagcctatgccttggacact
gcgttcctctcgctaatggaaagtgacccgacagaggagcttctcatgatcatagggata
ttctcccatttcttcgccctcgagacgacgcttgctgagcgccagttcttccgtgctttg
gcaaagctggtcgggcgccgtgccgcacggctaagcgcgtgtggtatcgcagctatcgtg
agcaaaatgggatacctggaggaaggctgctcagtcggtgccgatggctcgttgtacaac
aaataccctggcttcgcggatcgggtccacgaggggttgcaggatatctttggggacaaa
ggacggaacatcatcacgcaccacgctgaggatggcagcggtgtaggaagtgccatcatt
gcagcaatgacaaagatcagaaaagacaagggacagtatctgcatgtctag

DBGET integrated database retrieval system