KEGG   Homo sapiens (human): 79178Help
Entry
79178             CDS       T01001                                 

Gene name
THTPA, THTP, THTPASE
Definition
(RefSeq) thiamine triphosphatase
  KO
K05307  thiamine-triphosphatase [EC:3.6.1.28]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    79178 (THTPA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.28  thiamine-triphosphatase
     79178 (THTPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-GeneID: 79178
NCBI-ProteinID: NP_001119811
OMIM: 611612
HGNC: 18987
Ensembl: ENSG00000259431
Vega: OTTHUMG00000172558
Pharos: Q9BU02(Tbio)
UniProt: Q9BU02
LinkDB All DBs
Structure
PDB: 

Position
14q11.2
AA seq 230 aa AA seqDB search
MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS
GWELKCPGAAGVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVAS
FVTKRSAWKLVLLGADEEEPQLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSS
MLGVPAQETAPAKLIVYLQRFRPQDYQRLLEVNSSRERPQETEDPDHCLG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcccagggcttgattgaggtggagcgaaagttccttccagggcctggcacagaggag
cggctgcaggagttggggggcaccctggagtaccgggtcaccttccgagacacctactat
gacacccctgagctgagcctcatgcaggctgaccactggctgcgacgacgagaggatagt
ggatgggagctcaaatgtcctggagcagcaggtgtcttaggaccccacacggagtataag
gaactcacagcggaacctacaattgtggcccaactctgtaaggtgctgcgggctgacggc
ctgggggctggagatgtggctgctgtgctgggcccactggggctgcaggaagtagctagt
tttgtgactaagcggagtgcctggaagctggtgctcttgggagctgatgaagaggagcca
cagctcagggtggacttggatacagccgactttggctacgctgtgggtgaggtagaggcc
ctggtgcatgaggaggctgaagtaccaactgccctagagaagatccacaggctcagcagc
atgcttggtgtgcctgcacaggagacagcaccagccaagctgattgtgtatctacagcgt
ttccggcctcaagactatcagcgcctgctagaagtgaacagctccagagagaggccacag
gagactgaagatcctgaccactgcctgggctag

DBGET integrated database retrieval system